BLASTX nr result
ID: Rauwolfia21_contig00026553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00026553 (252 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW25630.1| hypothetical protein PHAVU_003G052200g [Phaseolus... 67 2e-09 gb|ESW25629.1| hypothetical protein PHAVU_003G052200g [Phaseolus... 67 2e-09 ref|XP_002525356.1| sentrin/sumo-specific protease, putative [Ri... 67 2e-09 gb|EOY00445.1| UB-like protease 1D [Theobroma cacao] 66 5e-09 ref|XP_003631300.1| PREDICTED: ubiquitin-like-specific protease ... 66 5e-09 emb|CBI32142.3| unnamed protein product [Vitis vinifera] 66 5e-09 ref|XP_006483837.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_006483836.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_006438408.1| hypothetical protein CICLE_v10031081mg [Citr... 65 1e-08 ref|XP_006438405.1| hypothetical protein CICLE_v10031081mg [Citr... 65 1e-08 ref|XP_006438404.1| hypothetical protein CICLE_v10031081mg [Citr... 65 1e-08 ref|XP_004509832.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_004509831.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_004509830.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_004509829.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_004509828.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_003551198.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_002315694.2| hypothetical protein POPTR_0010s04980g [Popu... 64 2e-08 ref|XP_006844951.1| hypothetical protein AMTR_s00058p00168420 [A... 64 3e-08 ref|XP_004965382.1| PREDICTED: ubiquitin-like-specific protease ... 63 4e-08 >gb|ESW25630.1| hypothetical protein PHAVU_003G052200g [Phaseolus vulgaris] Length = 428 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERLKKED Sbjct: 334 VPQQKNEYDCGLFVLYFIERFMEEAPERLKKED 366 >gb|ESW25629.1| hypothetical protein PHAVU_003G052200g [Phaseolus vulgaris] Length = 576 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERLKKED Sbjct: 482 VPQQKNEYDCGLFVLYFIERFMEEAPERLKKED 514 >ref|XP_002525356.1| sentrin/sumo-specific protease, putative [Ricinus communis] gi|223535319|gb|EEF36994.1| sentrin/sumo-specific protease, putative [Ricinus communis] Length = 283 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVLYF++RFIEEAPERLKK+D Sbjct: 200 VPQQKNDYDCGLFVLYFMERFIEEAPERLKKKD 232 >gb|EOY00445.1| UB-like protease 1D [Theobroma cacao] Length = 556 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RFIEEAPERLKK+D Sbjct: 478 VPQQKNDYDCGLFVLFFMERFIEEAPERLKKKD 510 >ref|XP_003631300.1| PREDICTED: ubiquitin-like-specific protease 1D-like [Vitis vinifera] Length = 304 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RFIEEAPERLKK+D Sbjct: 153 VPQQKNDYDCGLFVLFFMERFIEEAPERLKKKD 185 >emb|CBI32142.3| unnamed protein product [Vitis vinifera] Length = 221 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RFIEEAPERLKK+D Sbjct: 153 VPQQKNDYDCGLFVLFFMERFIEEAPERLKKKD 185 >ref|XP_006483837.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X2 [Citrus sinensis] Length = 571 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RF+EEAPERLKK+D Sbjct: 489 VPQQKNDYDCGLFVLFFMERFMEEAPERLKKKD 521 >ref|XP_006483836.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X1 [Citrus sinensis] Length = 574 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RF+EEAPERLKK+D Sbjct: 492 VPQQKNDYDCGLFVLFFMERFMEEAPERLKKKD 524 >ref|XP_006438408.1| hypothetical protein CICLE_v10031081mg [Citrus clementina] gi|557540604|gb|ESR51648.1| hypothetical protein CICLE_v10031081mg [Citrus clementina] Length = 571 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RF+EEAPERLKK+D Sbjct: 489 VPQQKNDYDCGLFVLFFMERFMEEAPERLKKKD 521 >ref|XP_006438405.1| hypothetical protein CICLE_v10031081mg [Citrus clementina] gi|557540601|gb|ESR51645.1| hypothetical protein CICLE_v10031081mg [Citrus clementina] Length = 574 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RF+EEAPERLKK+D Sbjct: 492 VPQQKNDYDCGLFVLFFMERFMEEAPERLKKKD 524 >ref|XP_006438404.1| hypothetical protein CICLE_v10031081mg [Citrus clementina] gi|557540600|gb|ESR51644.1| hypothetical protein CICLE_v10031081mg [Citrus clementina] Length = 415 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RF+EEAPERLKK+D Sbjct: 333 VPQQKNDYDCGLFVLFFMERFMEEAPERLKKKD 365 >ref|XP_004509832.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X5 [Cicer arietinum] Length = 419 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERL+K+D Sbjct: 311 VPQQKNEYDCGLFVLYFIERFMEEAPERLRKKD 343 >ref|XP_004509831.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X4 [Cicer arietinum] Length = 587 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERL+K+D Sbjct: 479 VPQQKNEYDCGLFVLYFIERFMEEAPERLRKKD 511 >ref|XP_004509830.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X3 [Cicer arietinum] Length = 588 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERL+K+D Sbjct: 480 VPQQKNEYDCGLFVLYFIERFMEEAPERLRKKD 512 >ref|XP_004509829.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X2 [Cicer arietinum] Length = 589 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERL+K+D Sbjct: 481 VPQQKNEYDCGLFVLYFIERFMEEAPERLRKKD 513 >ref|XP_004509828.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X1 [Cicer arietinum] Length = 590 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERL+K+D Sbjct: 482 VPQQKNEYDCGLFVLYFIERFMEEAPERLRKKD 514 >ref|XP_003551198.1| PREDICTED: ubiquitin-like-specific protease 1D-like [Glycine max] Length = 586 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RF+EEAPERLK++D Sbjct: 477 VPQQKNEYDCGLFVLYFIERFMEEAPERLKRKD 509 >ref|XP_002315694.2| hypothetical protein POPTR_0010s04980g [Populus trichocarpa] gi|550329091|gb|EEF01865.2| hypothetical protein POPTR_0010s04980g [Populus trichocarpa] Length = 354 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+NDYDCGLFVL+F++RFI+EAPERLKK D Sbjct: 185 VPQQKNDYDCGLFVLFFMERFIQEAPERLKKRD 217 >ref|XP_006844951.1| hypothetical protein AMTR_s00058p00168420 [Amborella trichopoda] gi|548847442|gb|ERN06626.1| hypothetical protein AMTR_s00058p00168420 [Amborella trichopoda] Length = 563 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/33 (78%), Positives = 33/33 (100%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKED 152 VPQQ+N+YDCGLFVLYFI+RFIE+APER++K+D Sbjct: 483 VPQQKNEYDCGLFVLYFIERFIEDAPERVRKKD 515 >ref|XP_004965382.1| PREDICTED: ubiquitin-like-specific protease 1D-like [Setaria italica] Length = 575 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 250 VPQQRNDYDCGLFVLYFIKRFIEEAPERLKKEDPS 146 VPQQ NDYDCGLFVLY+++RFI+EAPERL+K+D S Sbjct: 461 VPQQENDYDCGLFVLYYMQRFIQEAPERLQKKDLS 495