BLASTX nr result
ID: Rauwolfia21_contig00026217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00026217 (578 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY27956.1| Pentatricopeptide, putative [Theobroma cacao] 88 1e-15 ref|XP_004150218.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-15 gb|AHB18405.1| pentatricopeptide repeat-containing protein [Goss... 86 9e-15 gb|ACD56662.1| putative pentatricopeptide [Gossypium arboreum] 86 9e-15 gb|ACD56635.1| putative pentatricopeptide repeat protein [Gossyp... 86 9e-15 gb|AAT64030.1| putative pentatricopeptide repeat protein [Gossyp... 86 9e-15 ref|XP_002305733.2| hypothetical protein POPTR_0004s05810g, part... 85 2e-14 ref|XP_002265722.2| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 emb|CBI30711.3| unnamed protein product [Vitis vinifera] 85 2e-14 ref|XP_006467621.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-14 ref|XP_006449535.1| hypothetical protein CICLE_v10014413mg [Citr... 84 3e-14 gb|ACD56648.1| putative pentatricopeptide repeat protein [Gossyp... 84 3e-14 gb|AAT64016.1| putative pentatricopeptide repeat protein [Gossyp... 84 3e-14 ref|XP_006414062.1| hypothetical protein EUTSA_v10024377mg [Eutr... 83 4e-14 gb|ESW31464.1| hypothetical protein PHAVU_002G240000g [Phaseolus... 82 8e-14 gb|EXB84044.1| hypothetical protein L484_005808 [Morus notabilis] 80 5e-13 ref|XP_002870024.1| pentatricopeptide repeat-containing protein ... 80 5e-13 dbj|BAD94843.1| putative protein [Arabidopsis thaliana] 80 5e-13 ref|NP_193610.1| pentatricopeptide repeat protein DOT4 [Arabidop... 80 5e-13 ref|XP_004294643.1| PREDICTED: pentatricopeptide repeat-containi... 79 8e-13 >gb|EOY27956.1| Pentatricopeptide, putative [Theobroma cacao] Length = 874 Score = 88.2 bits (217), Expect = 1e-15 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 +CGDCHEMAK MSKE GREI+LRDSNRFHHFKDG CSCRG+W Sbjct: 833 ICGDCHEMAKFMSKETGREIVLRDSNRFHHFKDGYCSCRGFW 874 >ref|XP_004150218.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] gi|449500809|ref|XP_004161200.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Cucumis sativus] Length = 926 Score = 86.7 bits (213), Expect = 4e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDS+RFHHFKDGSCSCRGYW Sbjct: 885 VCGDCHEMAKFMSKSASREIILRDSSRFHHFKDGSCSCRGYW 926 >gb|AHB18405.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum] Length = 875 Score = 85.5 bits (210), Expect = 9e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSKE REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 834 VCGDCHEMAKFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 875 >gb|ACD56662.1| putative pentatricopeptide [Gossypium arboreum] Length = 805 Score = 85.5 bits (210), Expect = 9e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSKE REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 764 VCGDCHEMAKFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 805 >gb|ACD56635.1| putative pentatricopeptide repeat protein [Gossypium raimondii] Length = 667 Score = 85.5 bits (210), Expect = 9e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSKE REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 626 VCGDCHEMAKFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 667 >gb|AAT64030.1| putative pentatricopeptide repeat protein [Gossypium hirsutum] Length = 805 Score = 85.5 bits (210), Expect = 9e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSKE REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 764 VCGDCHEMAKFMSKETRREIVLRDSNRFHHFKDGYCSCRGFW 805 >ref|XP_002305733.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa] gi|550340410|gb|EEE86244.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa] Length = 778 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK +SK LGREI+LRDSNRFHHFKDG C CRG+W Sbjct: 737 VCGDCHEMAKFISKTLGREIVLRDSNRFHHFKDGVCCCRGFW 778 >ref|XP_002265722.2| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 824 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK + R+I+LRDSNRFHHFKDGSCSCRG+W Sbjct: 783 VCGDCHEMAKFMSKMVKRDIILRDSNRFHHFKDGSCSCRGHW 824 >emb|CBI30711.3| unnamed protein product [Vitis vinifera] Length = 697 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK + R+I+LRDSNRFHHFKDGSCSCRG+W Sbjct: 656 VCGDCHEMAKFMSKMVKRDIILRDSNRFHHFKDGSCSCRGHW 697 >ref|XP_006467621.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Citrus sinensis] Length = 872 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 831 VCGDCHEMAKFMSKTARREIVLRDSNRFHHFKDGRCSCRGFW 872 >ref|XP_006449535.1| hypothetical protein CICLE_v10014413mg [Citrus clementina] gi|557552146|gb|ESR62775.1| hypothetical protein CICLE_v10014413mg [Citrus clementina] Length = 725 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 684 VCGDCHEMAKFMSKTARREIVLRDSNRFHHFKDGRCSCRGFW 725 >gb|ACD56648.1| putative pentatricopeptide repeat protein [Gossypioides kirkii] Length = 805 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSKE REI+LRDSNRFHHFK+G CSCRG+W Sbjct: 764 VCGDCHEMAKFMSKETRREIVLRDSNRFHHFKNGYCSCRGFW 805 >gb|AAT64016.1| putative pentatricopeptide repeat protein [Gossypium hirsutum] Length = 805 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSKE REI+LRD NRFHHFKDG CSCRG+W Sbjct: 764 VCGDCHEMAKFMSKETRREIVLRDPNRFHHFKDGYCSCRGFW 805 >ref|XP_006414062.1| hypothetical protein EUTSA_v10024377mg [Eutrema salsugineum] gi|557115232|gb|ESQ55515.1| hypothetical protein EUTSA_v10024377mg [Eutrema salsugineum] Length = 872 Score = 83.2 bits (204), Expect = 4e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 831 VCGDCHEMAKLMSKLTRREIVLRDSNRFHHFKDGHCSCRGFW 872 >gb|ESW31464.1| hypothetical protein PHAVU_002G240000g [Phaseolus vulgaris] Length = 618 Score = 82.4 bits (202), Expect = 8e-14 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCH+M K MSK GR+I+LRDSNRFHHFKDG CSCRG+W Sbjct: 577 VCGDCHDMGKFMSKTTGRDIVLRDSNRFHHFKDGVCSCRGFW 618 >gb|EXB84044.1| hypothetical protein L484_005808 [Morus notabilis] Length = 877 Score = 79.7 bits (195), Expect = 5e-13 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHE AK +SK REI+LRDSNRFHHFKDG CSCRG+W Sbjct: 836 VCGDCHETAKFISKMSSREIVLRDSNRFHHFKDGHCSCRGFW 877 >ref|XP_002870024.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315860|gb|EFH46283.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 871 Score = 79.7 bits (195), Expect = 5e-13 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDSNRFH FKDG CSCRG+W Sbjct: 830 VCGDCHEMAKFMSKLTRREIVLRDSNRFHQFKDGHCSCRGFW 871 >dbj|BAD94843.1| putative protein [Arabidopsis thaliana] Length = 720 Score = 79.7 bits (195), Expect = 5e-13 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDSNRFH FKDG CSCRG+W Sbjct: 679 VCGDCHEMAKFMSKLTRREIVLRDSNRFHQFKDGHCSCRGFW 720 >ref|NP_193610.1| pentatricopeptide repeat protein DOT4 [Arabidopsis thaliana] gi|75206861|sp|Q9SN39.1|PP320_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g18750, chloroplastic; Flags: Precursor gi|4539394|emb|CAB37460.1| putative protein [Arabidopsis thaliana] gi|7268669|emb|CAB78877.1| putative protein [Arabidopsis thaliana] gi|332658686|gb|AEE84086.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 871 Score = 79.7 bits (195), Expect = 5e-13 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK MSK REI+LRDSNRFH FKDG CSCRG+W Sbjct: 830 VCGDCHEMAKFMSKLTRREIVLRDSNRFHQFKDGHCSCRGFW 871 >ref|XP_004294643.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 870 Score = 79.0 bits (193), Expect = 8e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 578 VCGDCHEMAKCMSKELGREILLRDSNRFHHFKDGSCSCRGYW 453 VCGDCHEMAK +S+ REI+LRDSNRFHH KDG+CSCRG+W Sbjct: 829 VCGDCHEMAKFISRTSRREIVLRDSNRFHHMKDGNCSCRGFW 870