BLASTX nr result
ID: Rauwolfia21_contig00025335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00025335 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433266.1| hypothetical protein CICLE_v10002028mg [Citr... 60 4e-07 >ref|XP_006433266.1| hypothetical protein CICLE_v10002028mg [Citrus clementina] gi|557535388|gb|ESR46506.1| hypothetical protein CICLE_v10002028mg [Citrus clementina] Length = 295 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = +1 Query: 196 KLNHALTTVRHVNKTDVVTLGSTFGVCP*IM*CAIYFKGLCILLSLVSSYCFFQSLTNIM 375 +L HALT+VR VNKTDVVTLGSTFGVC + ++ G+CI + + F QSL++IM Sbjct: 130 RLTHALTSVRSVNKTDVVTLGSTFGVCFLALFTSL-CAGVCICSCGPNGHLFLQSLSHIM 188 Query: 376 D 378 D Sbjct: 189 D 189