BLASTX nr result
ID: Rauwolfia21_contig00025286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00025286 (1328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37578.1| putative plastid-lipid-associated protein 11 [Mor... 65 6e-08 gb|EMJ19616.1| hypothetical protein PRUPE_ppa011530mg [Prunus pe... 65 6e-08 ref|XP_006653654.1| PREDICTED: probable plastid-lipid-associated... 65 8e-08 ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated... 65 8e-08 ref|XP_006490841.1| PREDICTED: probable plastid-lipid-associated... 62 5e-07 ref|XP_006445339.1| hypothetical protein CICLE_v10022767mg [Citr... 62 5e-07 gb|EMT21025.1| Putative plastid-lipid-associated protein 11, chl... 62 5e-07 gb|EMS54551.1| putative plastid-lipid-associated protein 11, chl... 62 5e-07 ref|XP_003580284.1| PREDICTED: probable plastid-lipid-associated... 62 5e-07 dbj|BAK05444.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 5e-07 ref|XP_004514232.1| PREDICTED: probable plastid-lipid-associated... 61 9e-07 ref|XP_004976442.1| PREDICTED: probable plastid-lipid-associated... 61 1e-06 gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japo... 61 1e-06 gb|EEC77764.1| hypothetical protein OsI_16907 [Oryza sativa Indi... 61 1e-06 ref|NP_001053499.1| Os04g0551700 [Oryza sativa Japonica Group] g... 61 1e-06 emb|CAE01685.2| OSJNBa0010H02.5 [Oryza sativa Japonica Group] 61 1e-06 ref|XP_006838194.1| hypothetical protein AMTR_s00106p00140380 [A... 60 2e-06 ref|XP_006359587.1| PREDICTED: probable plastid-lipid-associated... 60 2e-06 ref|XP_004248552.1| PREDICTED: probable plastid-lipid-associated... 60 2e-06 gb|ESW12973.1| hypothetical protein PHAVU_008G157000g [Phaseolus... 60 3e-06 >gb|EXB37578.1| putative plastid-lipid-associated protein 11 [Morus notabilis] Length = 211 Score = 65.1 bits (157), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 FDTVYLD EIRVVKDIRGDYLVV+RAPY+WKE Sbjct: 180 FDTVYLDDEIRVVKDIRGDYLVVDRAPYAWKE 211 >gb|EMJ19616.1| hypothetical protein PRUPE_ppa011530mg [Prunus persica] Length = 207 Score = 65.1 bits (157), Expect = 6e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 FDTVYLD EIRVVKDIRGDYLVV+RAPY+WKE Sbjct: 176 FDTVYLDDEIRVVKDIRGDYLVVDRAPYAWKE 207 >ref|XP_006653654.1| PREDICTED: probable plastid-lipid-associated protein 11-like [Oryza brachyantha] Length = 226 Score = 64.7 bits (156), Expect = 8e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 FDTVYLD+EIRV KDIRGDYLVVERAPYSW E Sbjct: 195 FDTVYLDNEIRVAKDIRGDYLVVERAPYSWNE 226 >ref|XP_004140490.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cucumis sativus] Length = 213 Score = 64.7 bits (156), Expect = 8e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 FDTVYLD EIRVVKDIRGDYL+VERAPYSW E Sbjct: 182 FDTVYLDDEIRVVKDIRGDYLIVERAPYSWTE 213 >ref|XP_006490841.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X1 [Citrus sinensis] Length = 222 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 F+TVYLD EIRVVKDIRGDYLVVERAPY W E Sbjct: 191 FETVYLDDEIRVVKDIRGDYLVVERAPYQWTE 222 >ref|XP_006445339.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905704|ref|XP_006445340.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905706|ref|XP_006445341.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|567905708|ref|XP_006445342.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547601|gb|ESR58579.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547602|gb|ESR58580.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547603|gb|ESR58581.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] gi|557547604|gb|ESR58582.1| hypothetical protein CICLE_v10022767mg [Citrus clementina] Length = 140 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 F+TVYLD EIRVVKDIRGDYLVVERAPY W E Sbjct: 109 FETVYLDDEIRVVKDIRGDYLVVERAPYQWTE 140 >gb|EMT21025.1| Putative plastid-lipid-associated protein 11, chloroplastic [Aegilops tauschii] Length = 145 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD EIRV KDIRGDYLVVERAPYSW Sbjct: 114 FDTVYLDDEIRVAKDIRGDYLVVERAPYSW 143 >gb|EMS54551.1| putative plastid-lipid-associated protein 11, chloroplastic [Triticum urartu] Length = 180 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD EIRV KDIRGDYLVVERAPYSW Sbjct: 149 FDTVYLDDEIRVAKDIRGDYLVVERAPYSW 178 >ref|XP_003580284.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Brachypodium distachyon] Length = 221 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD EIRV KDIRGDYLVVERAPYSW Sbjct: 190 FDTVYLDDEIRVAKDIRGDYLVVERAPYSW 219 >dbj|BAK05444.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 222 Score = 62.0 bits (149), Expect = 5e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD EIRV KDIRGDYLVVERAPYSW Sbjct: 191 FDTVYLDDEIRVAKDIRGDYLVVERAPYSW 220 >ref|XP_004514232.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Cicer arietinum] Length = 214 Score = 61.2 bits (147), Expect = 9e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 FDTVYLD ++RVVKDIRGDYLVV+RA YSWKE Sbjct: 183 FDTVYLDDDLRVVKDIRGDYLVVDRASYSWKE 214 >ref|XP_004976442.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Setaria italica] Length = 221 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD +IRV KDIRGDYLVVERAPYSW Sbjct: 190 FDTVYLDDDIRVAKDIRGDYLVVERAPYSW 219 >gb|EEE61457.1| hypothetical protein OsJ_15704 [Oryza sativa Japonica Group] Length = 228 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD +IRV KDIRGDYLVVERAPYSW Sbjct: 197 FDTVYLDDDIRVAKDIRGDYLVVERAPYSW 226 >gb|EEC77764.1| hypothetical protein OsI_16907 [Oryza sativa Indica Group] Length = 228 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD +IRV KDIRGDYLVVERAPYSW Sbjct: 197 FDTVYLDDDIRVAKDIRGDYLVVERAPYSW 226 >ref|NP_001053499.1| Os04g0551700 [Oryza sativa Japonica Group] gi|113565070|dbj|BAF15413.1| Os04g0551700, partial [Oryza sativa Japonica Group] Length = 215 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD +IRV KDIRGDYLVVERAPYSW Sbjct: 184 FDTVYLDDDIRVAKDIRGDYLVVERAPYSW 213 >emb|CAE01685.2| OSJNBa0010H02.5 [Oryza sativa Japonica Group] Length = 221 Score = 60.8 bits (146), Expect = 1e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSW 1237 FDTVYLD +IRV KDIRGDYLVVERAPYSW Sbjct: 190 FDTVYLDDDIRVAKDIRGDYLVVERAPYSW 219 >ref|XP_006838194.1| hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] gi|548840652|gb|ERN00763.1| hypothetical protein AMTR_s00106p00140380 [Amborella trichopoda] Length = 226 Score = 60.5 bits (145), Expect = 2e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 F+++YLD +IRVVKDIRGDYLVV+RAPY+WKE Sbjct: 195 FESIYLDDDIRVVKDIRGDYLVVDRAPYNWKE 226 >ref|XP_006359587.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X1 [Solanum tuberosum] gi|565387610|ref|XP_006359588.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X2 [Solanum tuberosum] gi|565387612|ref|XP_006359589.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X3 [Solanum tuberosum] gi|565387614|ref|XP_006359590.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X4 [Solanum tuberosum] gi|565387616|ref|XP_006359591.1| PREDICTED: probable plastid-lipid-associated protein 11-like isoform X5 [Solanum tuberosum] Length = 206 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 F+TVYLD +IRVVKDIR DYL+VERAPY+WKE Sbjct: 175 FETVYLDDDIRVVKDIRQDYLIVERAPYTWKE 206 >ref|XP_004248552.1| PREDICTED: probable plastid-lipid-associated protein 11, chloroplastic-like [Solanum lycopersicum] Length = 206 Score = 60.1 bits (144), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 F+TVYLD +IRVVKDIR DYL+VERAPY+WKE Sbjct: 175 FETVYLDDDIRVVKDIRQDYLIVERAPYTWKE 206 >gb|ESW12973.1| hypothetical protein PHAVU_008G157000g [Phaseolus vulgaris] Length = 209 Score = 59.7 bits (143), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 1326 FDTVYLDHEIRVVKDIRGDYLVVERAPYSWKE 1231 FDTVYLD ++RVVKDIRGDYLVV+RA Y WKE Sbjct: 178 FDTVYLDDDLRVVKDIRGDYLVVDRASYEWKE 209