BLASTX nr result
ID: Rauwolfia21_contig00025008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00025008 (504 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002374235.1| cytochrome b559 subunit alpha [Cyanothece sp... 62 8e-08 ref|WP_008276018.1| cytochrome b559 subunit alpha [Cyanothece sp... 62 8e-08 ref|NP_050864.1| photosystem II protein V [Nephroselmis olivacea... 62 1e-07 ref|YP_001802723.1| cytochrome b559 subunit alpha [Cyanothece sp... 62 1e-07 ref|NP_849131.1| photosystem II protein V [Cyanidioschyzon merol... 61 1e-07 ref|YP_006665797.1| photosystem II cytochrome b559 alpha subunit... 61 2e-07 gb|AAM53426.1| PsbE [Cuscuta gronovii] 61 2e-07 pir||T14570 cytochrome b559 component psbE - beet chloroplast gi... 61 2e-07 ref|NP_039315.1| photosystem II protein V [Marchantia polymorpha... 61 2e-07 ref|NP_042396.1| photosystem II protein V [Pinus thunbergii] gi|... 61 2e-07 ref|YP_008993193.1| photosystem II cytochrome b559 alpha subunit... 61 2e-07 gb|AHA12699.1| photosystem II cytochrome b559 alpha subunit [Orc... 61 2e-07 ref|XP_006404486.1| hypothetical protein EUTSA_v10011089mg, part... 61 2e-07 gb|AGQ55692.1| photosystem II protein V (chloroplast) [Alstroeme... 61 2e-07 ref|XP_006841194.1| hypothetical protein AMTR_s00334p00011530 [A... 61 2e-07 gb|AGW04683.1| photosystem II protein V [Matelea biflora] 61 2e-07 ref|YP_008474580.1| photosystem II cytochrome b559 alpha subunit... 61 2e-07 ref|YP_008474491.1| photosystem II cytochrome b559 alpha subunit... 61 2e-07 gb|EPS73280.1| cytochrome b559 subunit alpha, partial [Genlisea ... 61 2e-07 ref|YP_008378800.1| photosystem II protein V (chloroplast) [Naja... 61 2e-07 >ref|YP_002374235.1| cytochrome b559 subunit alpha [Cyanothece sp. PCC 8801] gi|257061926|ref|YP_003139814.1| cytochrome b559 subunit alpha [Cyanothece sp. PCC 8802] gi|506265355|ref|WP_015785130.1| cytochrome b559 subunit alpha [Cyanothece] gi|226712035|sp|B7K626.1|PSBE_CYAP8 RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|218169342|gb|ACK68079.1| cytochrome b559, alpha subunit [Cyanothece sp. PCC 8801] gi|256592092|gb|ACV02979.1| cytochrome b559, alpha subunit [Cyanothece sp. PCC 8802] Length = 81 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVFHRE 364 RYWVIH I IP LFIAG LFVSTGLA DVFG+P P + F +E Sbjct: 18 RYWVIHSITIPMLFIAGWLFVSTGLAYDVFGTPRPDQYFTQE 59 >ref|WP_008276018.1| cytochrome b559 subunit alpha [Cyanothece sp. CCY0110] gi|126620137|gb|EAZ90859.1| cytochrome b559 subunit alpha [Cyanothece sp. CCY0110] Length = 81 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVFHRE 364 RYWVIH I IP LFIAG LFVSTGLA DVFG+P P + F +E Sbjct: 18 RYWVIHSITIPMLFIAGWLFVSTGLAYDVFGTPRPDQYFTQE 59 >ref|NP_050864.1| photosystem II protein V [Nephroselmis olivacea] gi|31340300|sp|Q9TKY1.3|PSBE_NEPOL RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|5880742|gb|AAD54835.1|AF137379_58 cytochrome b559 alpha subunit of photosystem II (chloroplast) [Nephroselmis olivacea] Length = 83 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVFHRE 364 RYWVIH I IP LF+AG LFVSTGLA DVFGSP P F E Sbjct: 18 RYWVIHSITIPSLFVAGWLFVSTGLAYDVFGSPRPNEYFTEE 59 >ref|YP_001802723.1| cytochrome b559 subunit alpha [Cyanothece sp. ATCC 51142] gi|497229866|ref|WP_009544128.1| cytochrome b559 subunit alpha [Cyanothece sp. ATCC 51142] gi|254783430|sp|B1WVS0.1|PSBE_CYAA5 RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|171697676|gb|ACB50657.1| photosystem II cytochrome b559 alpha subunit [Cyanothece sp. ATCC 51142] Length = 81 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVFHRE 364 RYWVIH I IP LFIAG LFVSTGLA DVFG+P P F +E Sbjct: 18 RYWVIHSITIPMLFIAGWLFVSTGLAYDVFGTPRPDEYFTQE 59 >ref|NP_849131.1| photosystem II protein V [Cyanidioschyzon merolae strain 10D] gi|60390561|sp|Q85FQ2.1|PSBE_CYAME RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|30409344|dbj|BAC76293.1| cytochrome b559 alpha chain (chloroplast) [Cyanidioschyzon merolae strain 10D] Length = 81 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/42 (71%), Positives = 32/42 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVFHRE 364 RYWVIH I IP LFIAG LFVSTGLA DVFG+P P F +E Sbjct: 19 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFTQE 60 >ref|YP_006665797.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Elodea canadensis] gi|456061468|ref|YP_007475636.1| photosystem II cytochrome b559 alpha subunit [Heliconia collinsiana] gi|511943388|ref|YP_008081667.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium sinense] gi|511943501|ref|YP_008081823.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tracyanum] gi|512721449|ref|YP_008081745.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|556927249|ref|YP_008758205.1| cytochrome b559 alpha chain (chloroplast) [Veratrum patulum] gi|563940569|ref|YP_008854442.1| photosystem II cytochrome b559 alpha subunit [Musa textilis] gi|563940671|ref|YP_008854527.1| photosystem II cytochrome b559 alpha subunit [Ravenala madagascariensis] gi|548610|sp|P36442.2|PSBE_MESCR RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|437300|gb|AAA21857.1| cytochrome b-559 alpha subunit [Mesembryanthemum crystallinum] gi|156598315|gb|ABU85418.1| photosystem II cytochrome b559 alpha subunit [Musa acuminata] gi|374094613|gb|AEY84669.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Elodea canadensis] gi|374974833|gb|AFA27508.1| photosystem II cytochrome b559 alpha subunit, partial [Flagellaria indica] gi|374974849|gb|AFA27516.1| photosystem II cytochrome b559 alpha subunit, partial [Kingia australis] gi|374974887|gb|AFA27535.1| photosystem II cytochrome b559 alpha subunit, partial [Thurnia sphaerocephala] gi|392841355|gb|AFM83310.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Kingia australis] gi|408903948|gb|AFU96558.1| PsbE, partial (chloroplast) [Chrysobalanus icaco] gi|408903958|gb|AFU96563.1| PsbE, partial (chloroplast) [Euphorbia maculata] gi|408903978|gb|AFU96573.1| PsbE, partial (chloroplast) [Linum usitatissimum] gi|449326115|gb|AGE92701.1| photosystem II cytochrome b559 alpha subunit [Heliconia collinsiana] gi|449326896|gb|AGE93473.1| photosystem II cytochrome b559 alpha subunit [Xiphidium caeruleum] gi|482662138|gb|AGK25366.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium sinense] gi|482662217|gb|AGK25444.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|482662296|gb|AGK25522.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|482662454|gb|AGK25678.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tracyanum] gi|482662533|gb|AGK25756.1| cytochrome b559 alpha chain (chloroplast) [Cymbidium tortisepalum] gi|525312474|emb|CCW72392.1| psbF (chloroplast) [Musa acuminata subsp. malaccensis] gi|549531734|gb|AGX28860.1| cytochrome b559 alpha chain (chloroplast) [Veratrum patulum] gi|557636929|gb|AHA12531.1| photosystem II cytochrome b559 alpha subunit [Musa textilis] gi|557637015|gb|AHA12616.1| photosystem II cytochrome b559 alpha subunit [Ravenala madagascariensis] gi|557637173|gb|AHA12772.1| photosystem II cytochrome b559 alpha subunit [Canna indica] gi|557637257|gb|AHA12855.1| photosystem II cytochrome b559 alpha subunit [Maranta leuconeura] gi|557637344|gb|AHA12941.1| photosystem II cytochrome b559 alpha subunit [Monocostus uniflorus] gi|557637431|gb|AHA13027.1| photosystem II cytochrome b559 alpha subunit [Costus pulverulentus] gi|557637605|gb|AHA13199.1| photosystem II cytochrome b559 alpha subunit [Thaumatococcus daniellii] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AAM53426.1| PsbE [Cuscuta gronovii] Length = 84 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >pir||T14570 cytochrome b559 component psbE - beet chloroplast gi|860891|emb|CAA60967.1| PSII cytochome b559 alpha chain [Beta vulgaris subsp. vulgaris] gi|860897|emb|CAA60972.1| PSII cytochrome b599 alpha chain [Beta vulgaris subsp. vulgaris] Length = 118 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 53 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 91 >ref|NP_039315.1| photosystem II protein V [Marchantia polymorpha] gi|330850647|ref|YP_004376528.1| photosystem II cytochrome b559 alpha subunit [Ptilidium pulcherrimum] gi|131304|sp|P06851.3|PSBE_MARPO RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|11689|emb|CAA28101.1| psbE [Marchantia polymorpha] gi|302024776|gb|ADK89622.1| photosystem II cytochrome b559 alpha subunit [Ptilidium pulcherrimum] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|NP_042396.1| photosystem II protein V [Pinus thunbergii] gi|29565605|ref|NP_817184.1| photosystem II protein V [Pinus koraiensis] gi|222084101|ref|YP_002519554.1| cytochrome b559 alpha chain [Keteleeria davidiana] gi|512721648|ref|YP_008082266.1| photosystem II protein V (chloroplast) [Pinus massoniana] gi|512721722|ref|YP_008082339.1| photosystem II subunit V (chloroplast) [Pinus taeda] gi|1172678|sp|P41615.2|PSBE_PINTH RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|31340255|sp|P59703.3|PSBE_PINKO RecName: Full=Cytochrome b559 subunit alpha; AltName: Full=PSII reaction center subunit V gi|1262636|dbj|BAA04353.1| PSII cytochrome b559 subunit [Pinus thunbergii] gi|29469704|gb|AAO74032.1| PSII cytochrome b559 alpha chain [Pinus koraiensis] gi|220983653|dbj|BAH11419.1| cytochrome b559 alpha chain (chloroplast) [Keteleeria davidiana] gi|257042594|gb|ACV32866.1| photosystem II protein V [Pinus monticola] gi|356996608|gb|AET44525.1| photosystem II protein V (chloroplast) [Pinus chiapensis] gi|356996681|gb|AET44597.1| photosystem II protein V (chloroplast) [Pinus cembroides] gi|356996754|gb|AET44669.1| photosystem II protein V (chloroplast) [Pinus caribaea] gi|356996827|gb|AET44741.1| photosystem II protein V (chloroplast) [Pinus bungeana] gi|356996899|gb|AET44812.1| photosystem II protein V (chloroplast) [Pinus brutia] gi|356996971|gb|AET44883.1| photosystem II protein V (chloroplast) [Pinus arizonica] gi|356997044|gb|AET44955.1| photosystem II protein V (chloroplast) [Pinus amamiana] gi|356997116|gb|AET45026.1| photosystem II protein V (chloroplast) [Pinus yunnanensis] gi|356997186|gb|AET45095.1| photosystem II protein V (chloroplast) [Pinus yecorensis] gi|356997259|gb|AET45167.1| photosystem II protein V (chloroplast) [Pinus kwangtungensis] gi|356997331|gb|AET45238.1| photosystem II protein V (chloroplast) [Pinus wallichiana] gi|356997403|gb|AET45309.1| photosystem II protein V (chloroplast) [Pinus virginiana] gi|356997475|gb|AET45380.1| photosystem II protein V (chloroplast) [Pinus tropicalis] gi|356997548|gb|AET45452.1| photosystem II protein V (chloroplast) [Pinus taiwanensis] gi|356997621|gb|AET45524.1| photosystem II protein V (chloroplast) [Pinus sylvestris] gi|356997694|gb|AET45596.1| photosystem II protein V (chloroplast) [Pinus strobiformis] gi|356997766|gb|AET45667.1| photosystem II protein V (chloroplast) [Pinus serotina] gi|356997839|gb|AET45739.1| photosystem II protein V (chloroplast) [Pinus sabiniana] gi|356997911|gb|AET45810.1| photosystem II protein V (chloroplast) [Pinus roxburghii] gi|356997984|gb|AET45882.1| photosystem II protein V (chloroplast) [Pinus rigida] gi|356998057|gb|AET45954.1| photosystem II protein V (chloroplast) [Pinus remota] gi|356998130|gb|AET46026.1| photosystem II protein V (chloroplast) [Pinus radiata] gi|356998203|gb|AET46098.1| photosystem II protein V (chloroplast) [Pinus quadrifolia] gi|356998276|gb|AET46170.1| photosystem II protein V (chloroplast) [Pinus pungens] gi|356998349|gb|AET46242.1| photosystem II protein V (chloroplast) [Pinus pumila] gi|356998563|gb|AET46453.1| photosystem II protein V (chloroplast) [Pinus ponderosa var. scopulorum] gi|356998636|gb|AET46525.1| photosystem II protein V (chloroplast) [Pinus ponderosa var. benthamiana] gi|356998709|gb|AET46597.1| photosystem II protein V (chloroplast) [Pinus pinea] gi|356998782|gb|AET46669.1| photosystem II protein V (chloroplast) [Pinus pinceana] gi|356998855|gb|AET46741.1| photosystem II protein V (chloroplast) [Pinus patula] gi|356998928|gb|AET46813.1| photosystem II protein V (chloroplast) [Pinus palustris] gi|356999001|gb|AET46885.1| photosystem II protein V (chloroplast) [Pinus occidentalis] gi|356999074|gb|AET46957.1| photosystem II protein V (chloroplast) [Pinus pseudostrobus var. apulcensis] gi|356999147|gb|AET47029.1| photosystem II protein V (chloroplast) [Pinus nigra] gi|356999220|gb|AET47101.1| photosystem II protein V (chloroplast) [Pinus muricata] gi|356999292|gb|AET47172.1| photosystem II protein V (chloroplast) [Pinus mugo] gi|356999365|gb|AET47244.1| photosystem II protein V (chloroplast) [Pinus morrisonicola] gi|356999437|gb|AET47315.1| photosystem II protein V (chloroplast) [Pinus montezumae] gi|356999510|gb|AET47387.1| photosystem II protein V (chloroplast) [Pinus maximartinezii] gi|356999583|gb|AET47459.1| photosystem II protein V (chloroplast) [Pinus massoniana] gi|356999656|gb|AET47531.1| photosystem II protein V (chloroplast) [Pinus lumholtzii] gi|356999729|gb|AET47603.1| photosystem II protein V (chloroplast) [Pinus leiophylla] gi|356999802|gb|AET47675.1| photosystem II protein V (chloroplast) [Pinus lawsonii] gi|356999875|gb|AET47747.1| photosystem II protein V (chloroplast) [Pinus pringlei] gi|356999948|gb|AET47819.1| photosystem II protein V (chloroplast) [Pinus latteri] gi|357000021|gb|AET47891.1| photosystem II protein V (chloroplast) [Pinus kesiya] gi|357000094|gb|AET47963.1| photosystem II protein V (chloroplast) [Pinus johannis] gi|357000167|gb|AET48035.1| photosystem II protein V (chloroplast) [Pinus jeffreyi] gi|357000240|gb|AET48107.1| photosystem II protein V (chloroplast) [Pinus hwangshanensis] gi|357000313|gb|AET48179.1| photosystem II protein V (chloroplast) [Pinus heldreichii] gi|357000385|gb|AET48250.1| photosystem II protein V (chloroplast) [Pinus hartwegii] gi|357000458|gb|AET48322.1| photosystem II protein V (chloroplast) [Pinus halepensis] gi|357000530|gb|AET48393.1| photosystem II protein V (chloroplast) [Pinus greggii] gi|357000603|gb|AET48465.1| photosystem II protein V (chloroplast) [Pinus glabra] gi|357000676|gb|AET48537.1| photosystem II protein V (chloroplast) [Pinus fragilissima] gi|357000749|gb|AET48609.1| photosystem II protein V (chloroplast) [Pinus engelmannii] gi|357000822|gb|AET48681.1| photosystem II protein V (chloroplast) [Pinus elliottii] gi|357000895|gb|AET48753.1| photosystem II protein V (chloroplast) [Pinus edulis] gi|357000968|gb|AET48825.1| photosystem II protein V (chloroplast) [Pinus echinata] gi|357001042|gb|AET48898.1| photosystem II protein V (chloroplast) [Pinus douglasiana] gi|357001117|gb|AET48972.1| photosystem II protein V (chloroplast) [Pinus hartwegii] gi|357001190|gb|AET49044.1| photosystem II protein V (chloroplast) [Pinus discolor] gi|357001263|gb|AET49116.1| photosystem II protein V (chloroplast) [Pinus devoniana] gi|357001336|gb|AET49188.1| photosystem II protein V (chloroplast) [Pinus densata] gi|357001409|gb|AET49260.1| photosystem II protein V (chloroplast) [Pinus densiflora] gi|357001482|gb|AET49332.1| photosystem II protein V (chloroplast) [Pinus dalatensis] gi|357001554|gb|AET49403.1| photosystem II protein V (chloroplast) [Pinus fenzeliana var. dabeshanensis] gi|357001623|gb|AET49471.1| photosystem II protein V (chloroplast) [Pinus culminicola] gi|357001696|gb|AET49543.1| photosystem II protein V (chloroplast) [Pinus cubensis] gi|357001769|gb|AET49615.1| photosystem II protein V (chloroplast) [Pinus coulteri] gi|357001842|gb|AET49687.1| photosystem II protein V (chloroplast) [Pinus arizonica var. cooperi] gi|357001915|gb|AET49759.1| photosystem II protein V (chloroplast) [Pinus clausa] gi|490345110|gb|AGL11112.1| photosystem II protein V (chloroplast) [Pinus massoniana] gi|490345192|gb|AGL11185.1| photosystem II subunit V (chloroplast) [Pinus taeda] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_008993193.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Magnolia cathcartii] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|AHA12699.1| photosystem II cytochrome b559 alpha subunit [Orchidantha fimbriata] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|XP_006404486.1| hypothetical protein EUTSA_v10011089mg, partial [Eutrema salsugineum] gi|557105605|gb|ESQ45939.1| hypothetical protein EUTSA_v10011089mg, partial [Eutrema salsugineum] Length = 94 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 29 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 67 >gb|AGQ55692.1| photosystem II protein V (chloroplast) [Alstroemeria aurea] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|XP_006841194.1| hypothetical protein AMTR_s00334p00011530 [Amborella trichopoda] gi|548843101|gb|ERN02869.1| hypothetical protein AMTR_s00334p00011530 [Amborella trichopoda] Length = 162 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 97 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 135 >gb|AGW04683.1| photosystem II protein V [Matelea biflora] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_008474580.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Marsilea crenata] gi|474452517|gb|AGI51504.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Marsilea crenata] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_008474491.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Lygodium japonicum] gi|474452426|gb|AGI51414.1| photosystem II cytochrome b559 alpha subunit (chloroplast) [Lygodium japonicum] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >gb|EPS73280.1| cytochrome b559 subunit alpha, partial [Genlisea aurea] Length = 95 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56 >ref|YP_008378800.1| photosystem II protein V (chloroplast) [Najas flexilis] gi|427920131|gb|AFY64162.1| photosystem II protein V (chloroplast) [Najas flexilis] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = +2 Query: 239 RYWVIHCIAIPFLFIAG*LFVSTGLADDVFGSP*PKRVF 355 RYWVIH I IP LFIAG LFVSTGLA DVFGSP P F Sbjct: 18 RYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYF 56