BLASTX nr result
ID: Rauwolfia21_contig00024488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00024488 (370 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346158.1| PREDICTED: putative DUF21 domain-containing ... 60 9e-18 ref|XP_006346159.1| PREDICTED: putative DUF21 domain-containing ... 60 9e-18 ref|XP_006296606.1| hypothetical protein CARUB_v10013158mg [Caps... 59 2e-17 ref|NP_187914.1| CBS domain and transporter associated domain-co... 59 2e-17 ref|XP_002884940.1| CBS domain-containing protein [Arabidopsis l... 59 2e-17 ref|XP_004244043.1| PREDICTED: DUF21 domain-containing protein A... 59 2e-17 gb|EPS66961.1| hypothetical protein M569_07815, partial [Genlise... 59 3e-17 emb|CAN83218.1| hypothetical protein VITISV_018001 [Vitis vinifera] 59 6e-17 ref|XP_002273722.1| PREDICTED: DUF21 domain-containing protein A... 59 6e-17 ref|XP_006407264.1| hypothetical protein EUTSA_v10020238mg [Eutr... 57 6e-17 gb|EXB67418.1| DUF21 domain-containing protein [Morus notabilis] 59 6e-17 emb|CBI26747.3| unnamed protein product [Vitis vinifera] 59 6e-17 ref|XP_006595697.1| PREDICTED: putative DUF21 domain-containing ... 58 1e-16 ref|XP_003545104.2| PREDICTED: putative DUF21 domain-containing ... 58 1e-16 ref|XP_006452545.1| hypothetical protein CICLE_v10007688mg [Citr... 56 2e-16 ref|XP_006474932.1| PREDICTED: DUF21 domain-containing protein A... 56 2e-16 gb|EOY12101.1| CBS domain-containing protein / transporter assoc... 57 3e-16 gb|EOY12100.1| CBS domain-containing protein / transporter assoc... 57 3e-16 gb|EOY12102.1| CBS domain-containing protein / transporter assoc... 57 3e-16 gb|EMJ14793.1| hypothetical protein PRUPE_ppa002455mg [Prunus pe... 55 4e-16 >ref|XP_006346158.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 664 Score = 59.7 bits (143), Expect(2) = 9e-18 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLESS+VGDMAHKPAYFVPDSMSVW Sbjct: 405 VQKGELLESSVVGDMAHKPAYFVPDSMSVW 434 Score = 55.8 bits (133), Expect(2) = 9e-18 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 381 RVPVFEQRIDNIVGIAYAMDLLDYVQK 407 >ref|XP_006346159.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 469 Score = 59.7 bits (143), Expect(2) = 9e-18 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLESS+VGDMAHKPAYFVPDSMSVW Sbjct: 210 VQKGELLESSVVGDMAHKPAYFVPDSMSVW 239 Score = 55.8 bits (133), Expect(2) = 9e-18 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 186 RVPVFEQRIDNIVGIAYAMDLLDYVQK 212 >ref|XP_006296606.1| hypothetical protein CARUB_v10013158mg [Capsella rubella] gi|482565315|gb|EOA29504.1| hypothetical protein CARUB_v10013158mg [Capsella rubella] Length = 661 Score = 58.9 bits (141), Expect(2) = 2e-17 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KGDLLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 412 VQKGDLLESTSVGDMAHKPAYFVPDSMSVW 441 Score = 55.8 bits (133), Expect(2) = 2e-17 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 388 RVPVFEQRIDNIVGIAYAMDLLDYVQK 414 >ref|NP_187914.1| CBS domain and transporter associated domain-containing protein [Arabidopsis thaliana] gi|75273728|sp|Q9LK65.1|Y3307_ARATH RecName: Full=Putative DUF21 domain-containing protein At3g13070, chloroplastic; AltName: Full=CBS domain-containing protein CBSDUFCH1; Flags: Precursor gi|10172594|dbj|BAB01398.1| unnamed protein product [Arabidopsis thaliana] gi|332641769|gb|AEE75290.1| CBS domain and transporter associated domain-containing protein [Arabidopsis thaliana] Length = 661 Score = 58.9 bits (141), Expect(2) = 2e-17 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KGDLLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 412 VQKGDLLESTSVGDMAHKPAYFVPDSMSVW 441 Score = 55.8 bits (133), Expect(2) = 2e-17 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 388 RVPVFEQRIDNIVGIAYAMDLLDYVQK 414 >ref|XP_002884940.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330780|gb|EFH61199.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 660 Score = 58.9 bits (141), Expect(2) = 2e-17 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KGDLLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 412 VQKGDLLESTSVGDMAHKPAYFVPDSMSVW 441 Score = 55.8 bits (133), Expect(2) = 2e-17 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 388 RVPVFEQRIDNIVGIAYAMDLLDYVQK 414 >ref|XP_004244043.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like [Solanum lycopersicum] Length = 662 Score = 58.5 bits (140), Expect(2) = 2e-17 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLESS+VGD+AHKPAYFVPDSMSVW Sbjct: 402 VQKGELLESSIVGDIAHKPAYFVPDSMSVW 431 Score = 55.8 bits (133), Expect(2) = 2e-17 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 378 RVPVFEQRIDNIVGIAYAMDLLDYVQK 404 >gb|EPS66961.1| hypothetical protein M569_07815, partial [Genlisea aurea] Length = 238 Score = 58.5 bits (140), Expect(2) = 3e-17 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLESS VGDMAHKPAYFVPDSMSVW Sbjct: 162 VQKGELLESSKVGDMAHKPAYFVPDSMSVW 191 Score = 55.5 bits (132), Expect(2) = 3e-17 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFEERIDNIVGIAYAMDLLD+VQK Sbjct: 138 RVPVFEERIDNIVGIAYAMDLLDFVQK 164 >emb|CAN83218.1| hypothetical protein VITISV_018001 [Vitis vinifera] Length = 723 Score = 58.9 bits (141), Expect(2) = 6e-17 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 285 KGDLLESSLVGDMAHKPAYFVPDSMSVW 368 KG++LESS+VGDMAHKPAYFVPDSMSVW Sbjct: 460 KGEILESSIVGDMAHKPAYFVPDSMSVW 487 Score = 53.9 bits (128), Expect(2) = 6e-17 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVG+AYAMDLLDY+QK Sbjct: 434 RVPVFEQRVDNIVGVAYAMDLLDYLQK 460 >ref|XP_002273722.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic isoform 1 [Vitis vinifera] Length = 669 Score = 58.9 bits (141), Expect(2) = 6e-17 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 285 KGDLLESSLVGDMAHKPAYFVPDSMSVW 368 KG++LESS+VGDMAHKPAYFVPDSMSVW Sbjct: 406 KGEILESSIVGDMAHKPAYFVPDSMSVW 433 Score = 53.9 bits (128), Expect(2) = 6e-17 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVG+AYAMDLLDY+QK Sbjct: 380 RVPVFEQRVDNIVGVAYAMDLLDYLQK 406 >ref|XP_006407264.1| hypothetical protein EUTSA_v10020238mg [Eutrema salsugineum] gi|557108410|gb|ESQ48717.1| hypothetical protein EUTSA_v10020238mg [Eutrema salsugineum] Length = 660 Score = 57.0 bits (136), Expect(2) = 6e-17 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KGDLLE + VGDMAHKPAYFVPDSMSVW Sbjct: 412 VQKGDLLECTSVGDMAHKPAYFVPDSMSVW 441 Score = 55.8 bits (133), Expect(2) = 6e-17 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 388 RVPVFEQRIDNIVGIAYAMDLLDYVQK 414 >gb|EXB67418.1| DUF21 domain-containing protein [Morus notabilis] Length = 659 Score = 58.9 bits (141), Expect(2) = 6e-17 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KGDLLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 407 VRKGDLLESTSVGDMAHKPAYFVPDSMSVW 436 Score = 53.9 bits (128), Expect(2) = 6e-17 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVGIAYAMDLLDYV+K Sbjct: 383 RVPVFEQRVDNIVGIAYAMDLLDYVRK 409 >emb|CBI26747.3| unnamed protein product [Vitis vinifera] Length = 537 Score = 58.9 bits (141), Expect(2) = 6e-17 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +3 Query: 285 KGDLLESSLVGDMAHKPAYFVPDSMSVW 368 KG++LESS+VGDMAHKPAYFVPDSMSVW Sbjct: 274 KGEILESSIVGDMAHKPAYFVPDSMSVW 301 Score = 53.9 bits (128), Expect(2) = 6e-17 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVG+AYAMDLLDY+QK Sbjct: 248 RVPVFEQRVDNIVGVAYAMDLLDYLQK 274 >ref|XP_006595697.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic-like isoform X2 [Glycine max] Length = 681 Score = 57.8 bits (138), Expect(2) = 1e-16 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 415 VQKGELLESTTVGDMAHKPAYFVPDSMSVW 444 Score = 54.3 bits (129), Expect(2) = 1e-16 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNI+GIAYAMDLLDYVQK Sbjct: 391 RVPVFEQRVDNIMGIAYAMDLLDYVQK 417 >ref|XP_003545104.2| PREDICTED: putative DUF21 domain-containing protein At3g13070, chloroplastic-like isoform X1 [Glycine max] Length = 666 Score = 57.8 bits (138), Expect(2) = 1e-16 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 415 VQKGELLESTTVGDMAHKPAYFVPDSMSVW 444 Score = 54.3 bits (129), Expect(2) = 1e-16 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNI+GIAYAMDLLDYVQK Sbjct: 391 RVPVFEQRVDNIMGIAYAMDLLDYVQK 417 >ref|XP_006452545.1| hypothetical protein CICLE_v10007688mg [Citrus clementina] gi|568841978|ref|XP_006474931.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like isoform X1 [Citrus sinensis] gi|557555771|gb|ESR65785.1| hypothetical protein CICLE_v10007688mg [Citrus clementina] Length = 657 Score = 55.8 bits (133), Expect(2) = 2e-16 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 378 RVPVFEQRIDNIVGIAYAMDLLDYVQK 404 Score = 55.1 bits (131), Expect(2) = 2e-16 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLES+ V DMAHKPAYFVPDSMSVW Sbjct: 402 VQKGELLESTKVADMAHKPAYFVPDSMSVW 431 >ref|XP_006474932.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like isoform X2 [Citrus sinensis] Length = 604 Score = 55.8 bits (133), Expect(2) = 2e-16 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+RIDNIVGIAYAMDLLDYVQK Sbjct: 325 RVPVFEQRIDNIVGIAYAMDLLDYVQK 351 Score = 55.1 bits (131), Expect(2) = 2e-16 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLES+ V DMAHKPAYFVPDSMSVW Sbjct: 349 VQKGELLESTKVADMAHKPAYFVPDSMSVW 378 >gb|EOY12101.1| CBS domain-containing protein / transporter associated domain-containing protein isoform 2 [Theobroma cacao] Length = 676 Score = 57.4 bits (137), Expect(2) = 3e-16 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 285 KGDLLESSLVGDMAHKPAYFVPDSMSVW 368 KG+LLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 405 KGELLESTTVGDMAHKPAYFVPDSMSVW 432 Score = 53.1 bits (126), Expect(2) = 3e-16 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVGIAYAMDLLDYV K Sbjct: 379 RVPVFEQRVDNIVGIAYAMDLLDYVPK 405 >gb|EOY12100.1| CBS domain-containing protein / transporter associated domain-containing protein isoform 1 [Theobroma cacao] Length = 662 Score = 57.4 bits (137), Expect(2) = 3e-16 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 285 KGDLLESSLVGDMAHKPAYFVPDSMSVW 368 KG+LLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 405 KGELLESTTVGDMAHKPAYFVPDSMSVW 432 Score = 53.1 bits (126), Expect(2) = 3e-16 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVGIAYAMDLLDYV K Sbjct: 379 RVPVFEQRVDNIVGIAYAMDLLDYVPK 405 >gb|EOY12102.1| CBS domain-containing protein / transporter associated domain-containing protein isoform 3 [Theobroma cacao] Length = 655 Score = 57.4 bits (137), Expect(2) = 3e-16 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 285 KGDLLESSLVGDMAHKPAYFVPDSMSVW 368 KG+LLES+ VGDMAHKPAYFVPDSMSVW Sbjct: 406 KGELLESTTVGDMAHKPAYFVPDSMSVW 433 Score = 53.1 bits (126), Expect(2) = 3e-16 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVGIAYAMDLLDYV K Sbjct: 379 RVPVFEQRVDNIVGIAYAMDLLDYVPK 405 >gb|EMJ14793.1| hypothetical protein PRUPE_ppa002455mg [Prunus persica] Length = 671 Score = 55.5 bits (132), Expect(2) = 4e-16 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 91 RVPVFEERIDNIVGIAYAMDLLDYVQK 171 RVPVFE+R+DNIVGIAYAMDLLDYVQK Sbjct: 390 RVPVFEQRVDNIVGIAYAMDLLDYVQK 416 Score = 54.7 bits (130), Expect(2) = 4e-16 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +3 Query: 279 ILKGDLLESSLVGDMAHKPAYFVPDSMSVW 368 + KG+LLES+ VGDMA KPAYFVPDSMSVW Sbjct: 414 VQKGELLESTTVGDMAQKPAYFVPDSMSVW 443