BLASTX nr result
ID: Rauwolfia21_contig00024340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00024340 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY85174.1| alpha-amylase 2 [Manihot esculenta] 79 6e-13 ref|XP_002301935.2| hypothetical protein POPTR_0002s01570g [Popu... 79 8e-13 gb|AAF17626.1|AC009978_2 T23E18.6 [Arabidopsis thaliana] 76 4e-12 ref|NP_177740.1| alpha-amylase-like 2 [Arabidopsis thaliana] gi|... 76 4e-12 gb|AAX33234.1| cytosolic alpha-amylase [Malus domestica] 76 5e-12 gb|AAF63239.1|AF153828_1 alpha-amylase [Malus domestica] 76 5e-12 ref|XP_006302322.1| hypothetical protein CARUB_v10020375mg [Caps... 75 7e-12 gb|ESW32605.1| hypothetical protein PHAVU_001G001900g [Phaseolus... 75 1e-11 ref|XP_002510621.1| alpha-amylase, putative [Ricinus communis] g... 75 1e-11 ref|XP_006473736.1| PREDICTED: probable alpha-amylase 2-like [Ci... 74 2e-11 ref|XP_006435281.1| hypothetical protein CICLE_v100013481mg, par... 74 2e-11 gb|AFO84071.1| alpha-amylase [Actinidia chinensis] 74 2e-11 ref|XP_006390233.1| hypothetical protein EUTSA_v10018631mg [Eutr... 73 3e-11 ref|XP_004499317.1| PREDICTED: probable alpha-amylase 2-like iso... 73 3e-11 ref|XP_004499316.1| PREDICTED: probable alpha-amylase 2-like iso... 73 3e-11 ref|XP_004499315.1| PREDICTED: probable alpha-amylase 2-like iso... 73 3e-11 ref|XP_004499314.1| PREDICTED: probable alpha-amylase 2-like iso... 73 3e-11 ref|XP_002887626.1| hypothetical protein ARALYDRAFT_316534 [Arab... 73 4e-11 gb|EMJ26899.1| hypothetical protein PRUPE_ppa006402mg [Prunus pe... 72 6e-11 ref|XP_004238402.1| PREDICTED: probable alpha-amylase 2-like [So... 72 6e-11 >gb|AAY85174.1| alpha-amylase 2 [Manihot esculenta] Length = 407 Score = 79.0 bits (193), Expect = 6e-13 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEKICMK+GDGSWCPAG+EWTLATSGHRYA+WQK Sbjct: 374 GEKICMKIGDGSWCPAGKEWTLATSGHRYAVWQK 407 >ref|XP_002301935.2| hypothetical protein POPTR_0002s01570g [Populus trichocarpa] gi|550344061|gb|EEE81208.2| hypothetical protein POPTR_0002s01570g [Populus trichocarpa] Length = 410 Score = 78.6 bits (192), Expect = 8e-13 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCPAG+EWTLATSGHRYA+WQK Sbjct: 377 GEKVCMKIGDGSWCPAGKEWTLATSGHRYAVWQK 410 >gb|AAF17626.1|AC009978_2 T23E18.6 [Arabidopsis thaliana] Length = 412 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEKICMK+GDGSWCP+GR+WTLATSGHRYA+W K Sbjct: 379 GEKICMKLGDGSWCPSGRDWTLATSGHRYAVWHK 412 >ref|NP_177740.1| alpha-amylase-like 2 [Arabidopsis thaliana] gi|75301385|sp|Q8LFG1.1|AMY2_ARATH RecName: Full=Probable alpha-amylase 2; Short=AtAMY2; AltName: Full=1,4-alpha-D-glucan glucanohydrolase gi|21537093|gb|AAM61434.1| alpha-amylase, putative [Arabidopsis thaliana] gi|62320476|dbj|BAD94995.1| alpha-amylase like protein [Arabidopsis thaliana] gi|98960989|gb|ABF58978.1| At1g76130 [Arabidopsis thaliana] gi|332197679|gb|AEE35800.1| alpha-amylase-like 2 [Arabidopsis thaliana] Length = 413 Score = 76.3 bits (186), Expect = 4e-12 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEKICMK+GDGSWCP+GR+WTLATSGHRYA+W K Sbjct: 380 GEKICMKLGDGSWCPSGRDWTLATSGHRYAVWHK 413 >gb|AAX33234.1| cytosolic alpha-amylase [Malus domestica] Length = 414 Score = 75.9 bits (185), Expect = 5e-12 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEKICMK+GDGSWCPA REWTLATSGHRYA+W K Sbjct: 381 GEKICMKIGDGSWCPASREWTLATSGHRYAVWNK 414 >gb|AAF63239.1|AF153828_1 alpha-amylase [Malus domestica] Length = 413 Score = 75.9 bits (185), Expect = 5e-12 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCPAGREWTLAT GHRYA+W K Sbjct: 380 GEKVCMKIGDGSWCPAGREWTLATCGHRYAVWNK 413 >ref|XP_006302322.1| hypothetical protein CARUB_v10020375mg [Capsella rubella] gi|482571032|gb|EOA35220.1| hypothetical protein CARUB_v10020375mg [Capsella rubella] Length = 413 Score = 75.5 bits (184), Expect = 7e-12 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP+GR+WTLATSGHRYA+W K Sbjct: 380 GEKLCMKLGDGSWCPSGRDWTLATSGHRYAVWHK 413 >gb|ESW32605.1| hypothetical protein PHAVU_001G001900g [Phaseolus vulgaris] Length = 410 Score = 74.7 bits (182), Expect = 1e-11 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+G+GSWCP+GREWTLATSGH YA+WQK Sbjct: 377 GEKVCMKIGNGSWCPSGREWTLATSGHNYAVWQK 410 >ref|XP_002510621.1| alpha-amylase, putative [Ricinus communis] gi|223551322|gb|EEF52808.1| alpha-amylase, putative [Ricinus communis] Length = 398 Score = 74.7 bits (182), Expect = 1e-11 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSW P+GREWTLATSGHRYA+WQK Sbjct: 365 GEKVCMKIGDGSWSPSGREWTLATSGHRYAVWQK 398 >ref|XP_006473736.1| PREDICTED: probable alpha-amylase 2-like [Citrus sinensis] Length = 413 Score = 74.3 bits (181), Expect = 2e-11 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 G+K+CMK+GDGSWCPAG+EWTLATSGH+YA+W K Sbjct: 380 GDKVCMKIGDGSWCPAGKEWTLATSGHKYAVWHK 413 >ref|XP_006435281.1| hypothetical protein CICLE_v100013481mg, partial [Citrus clementina] gi|557537403|gb|ESR48521.1| hypothetical protein CICLE_v100013481mg, partial [Citrus clementina] Length = 395 Score = 74.3 bits (181), Expect = 2e-11 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 G+K+CMK+GDGSWCPAG+EWTLATSGH+YA+W K Sbjct: 362 GDKVCMKIGDGSWCPAGKEWTLATSGHKYAVWHK 395 >gb|AFO84071.1| alpha-amylase [Actinidia chinensis] Length = 413 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP GREWTLAT GHRYA+W K Sbjct: 380 GEKVCMKIGDGSWCPTGREWTLATCGHRYAVWHK 413 >ref|XP_006390233.1| hypothetical protein EUTSA_v10018631mg [Eutrema salsugineum] gi|567120821|ref|XP_006390234.1| hypothetical protein EUTSA_v10018631mg [Eutrema salsugineum] gi|557086667|gb|ESQ27519.1| hypothetical protein EUTSA_v10018631mg [Eutrema salsugineum] gi|557086668|gb|ESQ27520.1| hypothetical protein EUTSA_v10018631mg [Eutrema salsugineum] Length = 413 Score = 73.2 bits (178), Expect = 3e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GD SWCP+GR+WTLATSGHRYA+W K Sbjct: 380 GEKLCMKLGDASWCPSGRDWTLATSGHRYAVWHK 413 >ref|XP_004499317.1| PREDICTED: probable alpha-amylase 2-like isoform X4 [Cicer arietinum] Length = 413 Score = 73.2 bits (178), Expect = 3e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP+GREWTL+TSGH YA+W K Sbjct: 380 GEKLCMKIGDGSWCPSGREWTLSTSGHNYAVWHK 413 >ref|XP_004499316.1| PREDICTED: probable alpha-amylase 2-like isoform X3 [Cicer arietinum] Length = 414 Score = 73.2 bits (178), Expect = 3e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP+GREWTL+TSGH YA+W K Sbjct: 381 GEKLCMKIGDGSWCPSGREWTLSTSGHNYAVWHK 414 >ref|XP_004499315.1| PREDICTED: probable alpha-amylase 2-like isoform X2 [Cicer arietinum] Length = 415 Score = 73.2 bits (178), Expect = 3e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP+GREWTL+TSGH YA+W K Sbjct: 382 GEKLCMKIGDGSWCPSGREWTLSTSGHNYAVWHK 415 >ref|XP_004499314.1| PREDICTED: probable alpha-amylase 2-like isoform X1 [Cicer arietinum] Length = 416 Score = 73.2 bits (178), Expect = 3e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP+GREWTL+TSGH YA+W K Sbjct: 383 GEKLCMKIGDGSWCPSGREWTLSTSGHNYAVWHK 416 >ref|XP_002887626.1| hypothetical protein ARALYDRAFT_316534 [Arabidopsis lyrata subsp. lyrata] gi|297333467|gb|EFH63885.1| hypothetical protein ARALYDRAFT_316534 [Arabidopsis lyrata subsp. lyrata] Length = 413 Score = 72.8 bits (177), Expect = 4e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GDGSWCP+G +WTLATSGHRYA+W K Sbjct: 380 GEKLCMKLGDGSWCPSGGDWTLATSGHRYAVWHK 413 >gb|EMJ26899.1| hypothetical protein PRUPE_ppa006402mg [Prunus persica] Length = 413 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 3 GEKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 GEK+CMK+GD SWCP GREWTLAT GHRYAIW K Sbjct: 380 GEKVCMKIGDSSWCPTGREWTLATCGHRYAIWHK 413 >ref|XP_004238402.1| PREDICTED: probable alpha-amylase 2-like [Solanum lycopersicum] Length = 407 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 6 EKICMKMGDGSWCPAGREWTLATSGHRYAIWQK 104 EK+ MK+GDGSWCPAG+EWTLATSGHRYA+WQK Sbjct: 375 EKVSMKIGDGSWCPAGKEWTLATSGHRYAVWQK 407