BLASTX nr result
ID: Rauwolfia21_contig00024226
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00024226 (261 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgar... 88 1e-15 ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ri... 88 1e-15 ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 87 2e-15 ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 86 4e-15 gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus... 86 4e-15 ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 86 4e-15 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 86 4e-15 ref|XP_006302819.1| hypothetical protein CARUB_v10020943mg, part... 86 5e-15 sp|P16577.1|UBC4_WHEAT RecName: Full=Ubiquitin-conjugating enzym... 86 5e-15 ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 86 5e-15 ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805... 85 1e-14 ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4... 85 1e-14 gb|ACU23231.1| unknown [Glycine max] 85 1e-14 ref|NP_001242818.1| uncharacterized protein LOC100805356 [Glycin... 85 1e-14 gb|AFK34026.1| unknown [Medicago truncatula] 84 2e-14 ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 84 2e-14 ref|XP_004510772.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 84 3e-14 ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-2... 83 3e-14 ref|XP_006827545.1| hypothetical protein AMTR_s00009p00214490 [A... 83 3e-14 ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 83 3e-14 >dbj|BAK02014.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326492562|dbj|BAK02064.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326511283|dbj|BAJ87655.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326512886|dbj|BAK03350.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 184 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKVDMINDGM EF+VHFHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVDMINDGMQEFFVHFHGPNDS 42 >ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] gi|223549063|gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] Length = 183 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNDS 42 >ref|XP_003557690.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Brachypodium distachyon] Length = 186 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+M+NDGM EFYVHFHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFYVHFHGPNDS 42 >ref|XP_006598954.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X2 [Glycine max] Length = 155 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >gb|ESW07087.1| hypothetical protein PHAVU_010G100200g [Phaseolus vulgaris] Length = 183 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] Length = 183 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like isoform X1 [Glycine max] Length = 183 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGPN+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|XP_006302819.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella] gi|482571529|gb|EOA35717.1| hypothetical protein CARUB_v10020943mg, partial [Capsella rubella] Length = 214 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/61 (67%), Positives = 48/61 (78%) Frame = +1 Query: 79 QYTEISRKDQKKKRISREIMSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPND 258 Q ++ +K +K RE MSSPSKRREMDLMKLMMSDYKV+MINDGM EF+V F+GP D Sbjct: 11 QDSQKKKKTNSEKNDKREAMSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFNGPKD 70 Query: 259 S 261 S Sbjct: 71 S 71 >sp|P16577.1|UBC4_WHEAT RecName: Full=Ubiquitin-conjugating enzyme E2-23 kDa; AltName: Full=Ubiquitin carrier protein; AltName: Full=Ubiquitin-protein ligase gi|170782|gb|AAA34309.1| ubiquitin carrier protein [Triticum aestivum] Length = 184 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKVDMINDGM+EF+VHFHGP DS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDS 42 >ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Vitis vinifera] gi|147789691|emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera] gi|297745317|emb|CBI40397.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGP+DS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDS 42 >ref|XP_006586692.1| PREDICTED: uncharacterized protein LOC100805356 isoform X1 [Glycine max] Length = 166 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV FHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDS 42 >ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 4-like [Glycine max] Length = 183 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV FHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDS 42 >gb|ACU23231.1| unknown [Glycine max] Length = 102 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV FHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDS 42 >ref|NP_001242818.1| uncharacterized protein LOC100805356 [Glycine max] gi|255625833|gb|ACU13261.1| unknown [Glycine max] Length = 183 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV FHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVQFHGPNDS 42 >gb|AFK34026.1| unknown [Medicago truncatula] Length = 185 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGP++S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSES 42 >ref|XP_006339599.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum tuberosum] Length = 184 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGP +S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPTES 42 >ref|XP_004510772.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Cicer arietinum] Length = 184 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYV FHGPNDS Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVIFHGPNDS 42 >ref|XP_006358673.1| PREDICTED: ubiquitin-conjugating enzyme E2-23 kDa-like [Solanum tuberosum] Length = 183 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGP +S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAES 42 >ref|XP_006827545.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda] gi|548832165|gb|ERM94961.1| hypothetical protein AMTR_s00009p00214490 [Amborella trichopoda] Length = 183 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRR+MDLMKLMMSDYKVDMINDGM EFYV FHGPN+S Sbjct: 1 MSSPSKRRDMDLMKLMMSDYKVDMINDGMQEFYVDFHGPNES 42 >ref|XP_004248050.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Solanum lycopersicum] Length = 183 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 136 MSSPSKRREMDLMKLMMSDYKVDMINDGMNEFYVHFHGPNDS 261 MSSPSKRREMDLMKLMMSDYKV+MINDGM EFYVHFHGP +S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPAES 42