BLASTX nr result
ID: Rauwolfia21_contig00023861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00023861 (737 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Popu... 57 8e-06 >ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa] gi|550348102|gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa] Length = 167 Score = 56.6 bits (135), Expect = 8e-06 Identities = 30/87 (34%), Positives = 51/87 (58%), Gaps = 5/87 (5%) Frame = -3 Query: 405 PGLQSTKHSGSVKETRGLPDGWITEEKVRKLGMSAGHKDKTYIEVITNKRCRSIPDVWRY 226 P + + S + +T LP GW+ E++VR G +AG +DK YIE ++ +R RS DV Y Sbjct: 57 PVREKRRLSETAVDTSWLPPGWVVEDRVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYY 116 Query: 225 IE-----KQRKLQGEIEANKDEASCIP 160 +E K+ K+ ++A+ ++ + IP Sbjct: 117 LETGTLKKRGKVAENVDADTNKQTKIP 143