BLASTX nr result
ID: Rauwolfia21_contig00023351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00023351 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB57414.1| putative aarF domain-containing protein kinase [M... 83 4e-14 ref|XP_004167199.1| PREDICTED: uncharacterized aarF domain-conta... 83 4e-14 ref|XP_004139782.1| PREDICTED: uncharacterized aarF domain-conta... 83 4e-14 tpg|DAA35774.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 82 1e-13 tpg|DAA35772.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 82 1e-13 tpg|DAA35771.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 82 1e-13 tpg|DAA35773.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea m... 82 1e-13 ref|XP_004976991.1| PREDICTED: uncharacterized aarF domain-conta... 81 1e-13 ref|XP_002527120.1| Protein ABC1, mitochondrial precursor, putat... 81 2e-13 ref|XP_006599454.1| PREDICTED: uncharacterized aarF domain-conta... 80 2e-13 ref|XP_002300887.2| ABC1 family protein [Populus trichocarpa] gi... 80 2e-13 emb|CBI29334.3| unnamed protein product [Vitis vinifera] 80 2e-13 ref|XP_002447194.1| hypothetical protein SORBIDRAFT_06g030250 [S... 80 2e-13 ref|XP_002264943.1| PREDICTED: uncharacterized aarF domain-conta... 80 2e-13 ref|XP_006652892.1| PREDICTED: uncharacterized aarF domain-conta... 80 3e-13 ref|XP_006473162.1| PREDICTED: uncharacterized aarF domain-conta... 80 3e-13 ref|XP_006359010.1| PREDICTED: uncharacterized aarF domain-conta... 80 3e-13 ref|XP_006434574.1| hypothetical protein CICLE_v10000457mg [Citr... 80 3e-13 ref|XP_006434572.1| hypothetical protein CICLE_v10000457mg [Citr... 80 3e-13 gb|EOY17425.1| Kinase superfamily protein [Theobroma cacao] 80 3e-13 >gb|EXB57414.1| putative aarF domain-containing protein kinase [Morus notabilis] Length = 703 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFKQELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 366 DFGMMGEFKQELRDGFIEACLHLVNRDFDALAKDFVTLG 404 >ref|XP_004167199.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Cucumis sativus] Length = 550 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFKQELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 218 DFGMMGEFKQELRDGFIEACLHLVNRDFDALAKDFVTLG 256 >ref|XP_004139782.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Cucumis sativus] Length = 702 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFKQELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 369 DFGMMGEFKQELRDGFIEACLHLVNRDFDALAKDFVTLG 407 >tpg|DAA35774.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 304 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+QELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 98 DFGMMGEFRQELRDGFIEACLHLVNRDFDALAKDFVTLG 136 >tpg|DAA35772.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 521 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+QELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 177 DFGMMGEFRQELRDGFIEACLHLVNRDFDALAKDFVTLG 215 >tpg|DAA35771.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 703 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+QELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 359 DFGMMGEFRQELRDGFIEACLHLVNRDFDALAKDFVTLG 397 >tpg|DAA35773.1| TPA: hypothetical protein ZEAMMB73_733121 [Zea mays] Length = 442 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+QELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 98 DFGMMGEFRQELRDGFIEACLHLVNRDFDALAKDFVTLG 136 >ref|XP_004976991.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like isoform X1 [Setaria italica] gi|514804235|ref|XP_004976992.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like isoform X2 [Setaria italica] Length = 709 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+QELRDGFIEACLHLVNRD+DALAKDF+TLG Sbjct: 364 DFGMMGEFRQELRDGFIEACLHLVNRDFDALAKDFITLG 402 >ref|XP_002527120.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis] gi|223533543|gb|EEF35283.1| Protein ABC1, mitochondrial precursor, putative [Ricinus communis] Length = 711 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFKQELRDGFIEACLHLVNRD+DALAKDF TLG Sbjct: 367 DFGMMGEFKQELRDGFIEACLHLVNRDFDALAKDFFTLG 405 >ref|XP_006599454.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Glycine max] Length = 697 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGM GEFKQELRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 358 DFGMTGEFKQELRDGFIEACLHLVNRDFDALAKDFVTLG 396 >ref|XP_002300887.2| ABC1 family protein [Populus trichocarpa] gi|550344387|gb|EEE80160.2| ABC1 family protein [Populus trichocarpa] Length = 704 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLGY 281 DFGMMGEF QE RDGFIEACLHLVNRD+DALAKDFVTLG+ Sbjct: 361 DFGMMGEFNQEFRDGFIEACLHLVNRDFDALAKDFVTLGF 400 >emb|CBI29334.3| unnamed protein product [Vitis vinifera] Length = 714 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+ ELRDGFIEACLHLVNRDYDALAKDFVTLG Sbjct: 369 DFGMMGEFEPELRDGFIEACLHLVNRDYDALAKDFVTLG 407 >ref|XP_002447194.1| hypothetical protein SORBIDRAFT_06g030250 [Sorghum bicolor] gi|241938377|gb|EES11522.1| hypothetical protein SORBIDRAFT_06g030250 [Sorghum bicolor] Length = 706 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+Q+LRDGFIEACLHLVNRD+DALAKDFVTLG Sbjct: 360 DFGMMGEFRQDLRDGFIEACLHLVNRDFDALAKDFVTLG 398 >ref|XP_002264943.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Vitis vinifera] Length = 713 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+ ELRDGFIEACLHLVNRDYDALAKDFVTLG Sbjct: 369 DFGMMGEFEPELRDGFIEACLHLVNRDYDALAKDFVTLG 407 >ref|XP_006652892.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Oryza brachyantha] Length = 719 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEF+QELRDGFIEACLHLVNRD+D LAKDFVTLG Sbjct: 375 DFGMMGEFRQELRDGFIEACLHLVNRDFDGLAKDFVTLG 413 >ref|XP_006473162.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Citrus sinensis] Length = 704 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFK+ELR+GFIEACLHLVNRD+DALAKDFVTLG Sbjct: 363 DFGMMGEFKEELREGFIEACLHLVNRDFDALAKDFVTLG 401 >ref|XP_006359010.1| PREDICTED: uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic-like [Solanum tuberosum] Length = 708 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFKQE RDGFIEACLHLVNRDY ALAKDFVTLG Sbjct: 365 DFGMMGEFKQEYRDGFIEACLHLVNRDYSALAKDFVTLG 403 >ref|XP_006434574.1| hypothetical protein CICLE_v10000457mg [Citrus clementina] gi|557536696|gb|ESR47814.1| hypothetical protein CICLE_v10000457mg [Citrus clementina] Length = 701 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFK+ELR+GFIEACLHLVNRD+DALAKDFVTLG Sbjct: 360 DFGMMGEFKEELREGFIEACLHLVNRDFDALAKDFVTLG 398 >ref|XP_006434572.1| hypothetical protein CICLE_v10000457mg [Citrus clementina] gi|567884029|ref|XP_006434573.1| hypothetical protein CICLE_v10000457mg [Citrus clementina] gi|557536694|gb|ESR47812.1| hypothetical protein CICLE_v10000457mg [Citrus clementina] gi|557536695|gb|ESR47813.1| hypothetical protein CICLE_v10000457mg [Citrus clementina] Length = 588 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 39/39 (100%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFK+ELR+GFIEACLHLVNRD+DALAKDFVTLG Sbjct: 360 DFGMMGEFKEELREGFIEACLHLVNRDFDALAKDFVTLG 398 >gb|EOY17425.1| Kinase superfamily protein [Theobroma cacao] Length = 703 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 162 DFGMMGEFKQELRDGFIEACLHLVNRDYDALAKDFVTLG 278 DFGMMGEFKQE RDGFIEACLHLVNRD+DAL+KDFVTLG Sbjct: 357 DFGMMGEFKQEFRDGFIEACLHLVNRDFDALSKDFVTLG 395