BLASTX nr result
ID: Rauwolfia21_contig00023257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00023257 (1167 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232824.1| PREDICTED: uncharacterized protein LOC101260... 59 5e-06 ref|XP_006361017.1| PREDICTED: uncharacterized protein LOC102578... 58 6e-06 gb|EPS65991.1| hypothetical protein M569_08784, partial [Genlise... 58 8e-06 >ref|XP_004232824.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum] Length = 405 Score = 58.5 bits (140), Expect = 5e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 91 GDRTKKVGVVDSEYIVHQSIQTLGGQSAKK 2 GDR+KKVGVVDSEY+VHQSIQTLGGQS KK Sbjct: 306 GDRSKKVGVVDSEYVVHQSIQTLGGQSLKK 335 >ref|XP_006361017.1| PREDICTED: uncharacterized protein LOC102578269 isoform X1 [Solanum tuberosum] gi|565390588|ref|XP_006361018.1| PREDICTED: uncharacterized protein LOC102578269 isoform X2 [Solanum tuberosum] Length = 408 Score = 58.2 bits (139), Expect = 6e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 91 GDRTKKVGVVDSEYIVHQSIQTLGGQSAKK 2 GDRTKKVGVVDSEYIVHQSIQTLGG S KK Sbjct: 309 GDRTKKVGVVDSEYIVHQSIQTLGGPSLKK 338 >gb|EPS65991.1| hypothetical protein M569_08784, partial [Genlisea aurea] Length = 398 Score = 57.8 bits (138), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 91 GDRTKKVGVVDSEYIVHQSIQTLGGQSAKK 2 GDRTKKVG+VDSEY++HQ IQTLGG SAKK Sbjct: 312 GDRTKKVGIVDSEYVIHQGIQTLGGSSAKK 341