BLASTX nr result
ID: Rauwolfia21_contig00022448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00022448 (244 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60183.1| hypothetical protein M569_14621, partial [Genlise... 50 5e-06 >gb|EPS60183.1| hypothetical protein M569_14621, partial [Genlisea aurea] Length = 307 Score = 50.1 bits (118), Expect(2) = 5e-06 Identities = 25/66 (37%), Positives = 34/66 (51%) Frame = -2 Query: 198 SYQPLIRKIAAPSDPRVADLILPNPRRWNFYLFQTFFHQRDMEIIRSIPLCHSPRQDTPI 19 S++PL R VADL + RRWN L + FH D +I +PL H D I Sbjct: 147 SFKPLFRNPLHSEAFLVADLFILGQRRWNQPLIRRMFHPIDANLILQLPLAHHHADDLLI 206 Query: 18 WHFTKS 1 W++TK+ Sbjct: 207 WNYTKN 212 Score = 25.8 bits (55), Expect(2) = 5e-06 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 244 LAQGLRWRVGRG 209 L QGLRWRVG G Sbjct: 120 LCQGLRWRVGSG 131