BLASTX nr result
ID: Rauwolfia21_contig00022263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00022263 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004502036.1| PREDICTED: RNA-binding protein Musashi homol... 59 7e-07 >ref|XP_004502036.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Cicer arietinum] Length = 180 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/69 (44%), Positives = 39/69 (56%) Frame = -2 Query: 208 YLARRLLTAVIIHHRQPPSKLYCXXXXXXXXXXXXXXXPNNKLFVGGLSWSINEKIVKDA 29 + A + T + + H PPS C +NKLFVGGLSWS++EK +KDA Sbjct: 41 FFASTIFTKLQLQH--PPSHFQCRFYSSSPSPSPSPSPSSNKLFVGGLSWSVDEKSLKDA 98 Query: 28 FSSFGVVTE 2 FSSFG VTE Sbjct: 99 FSSFGDVTE 107