BLASTX nr result
ID: Rauwolfia21_contig00022261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00022261 (525 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006386724.1| hypothetical protein POPTR_0002s20040g [Popu... 60 3e-07 ref|XP_002515319.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_006386724.1| hypothetical protein POPTR_0002s20040g [Populus trichocarpa] gi|550345433|gb|ERP64521.1| hypothetical protein POPTR_0002s20040g [Populus trichocarpa] Length = 86 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 307 GKALAHRALYGPNTSRRGKSRKHRNQDNKALPSRLSRVSLAEDYETAD 164 GKALAHRALYG ++SR G SRK R+ D K LPSRLS+VSLA+D E + Sbjct: 40 GKALAHRALYG-SSSRHGGSRKARSSDVKTLPSRLSKVSLADDTENRE 86 >ref|XP_002515319.1| conserved hypothetical protein [Ricinus communis] gi|223545799|gb|EEF47303.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -3 Query: 307 GKALAHRALYGPNTSRRGKSRKHRNQDNKALPSRLSRVSLAEDYE 173 GKALAHRALYG ++SRR SRK R+ D + LPSRLS VSLA+D E Sbjct: 39 GKALAHRALYG-SSSRRAGSRKVRDNDTRTLPSRLSNVSLADDEE 82