BLASTX nr result
ID: Rauwolfia21_contig00021581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00021581 (449 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36255.1| RNA-binding protein 40 [Morus notabilis] 57 2e-06 ref|XP_002525464.1| RNA binding protein, putative [Ricinus commu... 57 3e-06 ref|NP_172394.1| RNA-binding (RRM/RBD/RNP motifs) family protein... 57 3e-06 ref|XP_006605188.1| PREDICTED: RNA-binding protein 40-like [Glyc... 57 3e-06 ref|XP_003548764.1| PREDICTED: RNA-binding protein 40-like [Glyc... 57 3e-06 ref|XP_002270244.2| PREDICTED: RNA-binding protein 40-like [Viti... 57 3e-06 ref|XP_006479054.1| PREDICTED: RNA-binding protein 40-like isofo... 56 4e-06 ref|XP_006443354.1| hypothetical protein CICLE_v10020067mg [Citr... 56 4e-06 ref|XP_002892494.1| RNA recognition motif-containing protein [Ar... 56 4e-06 gb|EMJ08652.1| hypothetical protein PRUPE_ppa005530mg [Prunus pe... 56 6e-06 gb|EOY10724.1| RNA-binding family protein isoform 5 [Theobroma c... 55 7e-06 gb|EOY10720.1| RNA-binding family protein isoform 1 [Theobroma c... 55 7e-06 ref|XP_004230890.1| PREDICTED: RNA-binding protein 40-like isofo... 55 7e-06 ref|XP_003632078.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding ... 55 7e-06 emb|CBI36672.3| unnamed protein product [Vitis vinifera] 55 7e-06 >gb|EXB36255.1| RNA-binding protein 40 [Morus notabilis] Length = 486 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 340 SIVGICYFQEGRMRGQAFVTFPSIELAHDALNLVNG 447 S + + QEGRMRGQAFVTFPS+ELAH ALNLVNG Sbjct: 427 SSLNVKLMQEGRMRGQAFVTFPSVELAHHALNLVNG 462 >ref|XP_002525464.1| RNA binding protein, putative [Ricinus communis] gi|223535277|gb|EEF36954.1| RNA binding protein, putative [Ricinus communis] Length = 450 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALNLVNG Sbjct: 401 QEGRMRGQAFVTFPSVELAHQALNLVNG 428 >ref|NP_172394.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana] gi|20258828|gb|AAM13896.1| unknown protein [Arabidopsis thaliana] gi|21689717|gb|AAM67480.1| unknown protein [Arabidopsis thaliana] gi|332190295|gb|AEE28416.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis thaliana] Length = 442 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 340 SIVGICYFQEGRMRGQAFVTFPSIELAHDALNLVNG 447 S +G+ QEGRMRGQAF+TFPS+E+AH ALNLVNG Sbjct: 384 SSLGVRLMQEGRMRGQAFLTFPSVEVAHRALNLVNG 419 >ref|XP_006605188.1| PREDICTED: RNA-binding protein 40-like [Glycine max] Length = 453 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAF+TFPSIELAH ALNLVNG Sbjct: 417 QEGRMRGQAFITFPSIELAHHALNLVNG 444 >ref|XP_003548764.1| PREDICTED: RNA-binding protein 40-like [Glycine max] Length = 456 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAF+TFPSIELAH ALNLVNG Sbjct: 407 QEGRMRGQAFITFPSIELAHHALNLVNG 434 >ref|XP_002270244.2| PREDICTED: RNA-binding protein 40-like [Vitis vinifera] gi|298205172|emb|CBI17231.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALNLVNG Sbjct: 414 QEGRMRGQAFVTFPSVELAHHALNLVNG 441 >ref|XP_006479054.1| PREDICTED: RNA-binding protein 40-like isoform X2 [Citrus sinensis] Length = 389 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALNLVNG Sbjct: 340 QEGRMRGQAFVTFPSVELAHRALNLVNG 367 >ref|XP_006443354.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] gi|567901734|ref|XP_006443355.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] gi|568850729|ref|XP_006479053.1| PREDICTED: RNA-binding protein 40-like isoform X1 [Citrus sinensis] gi|557545616|gb|ESR56594.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] gi|557545617|gb|ESR56595.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] Length = 461 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALNLVNG Sbjct: 412 QEGRMRGQAFVTFPSVELAHRALNLVNG 439 >ref|XP_002892494.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338336|gb|EFH68753.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 438 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 346 VGICYFQEGRMRGQAFVTFPSIELAHDALNLVNG 447 +G+ QEGRMRGQAF+TFPS+E+AH ALNLVNG Sbjct: 382 LGVRLMQEGRMRGQAFLTFPSVEVAHRALNLVNG 415 >gb|EMJ08652.1| hypothetical protein PRUPE_ppa005530mg [Prunus persica] Length = 456 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALNLVNG Sbjct: 407 QEGRMRGQAFVTFPSVELAHYALNLVNG 434 >gb|EOY10724.1| RNA-binding family protein isoform 5 [Theobroma cacao] Length = 345 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFP++ELAH ALNLVNG Sbjct: 296 QEGRMRGQAFVTFPAVELAHHALNLVNG 323 >gb|EOY10720.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508718824|gb|EOY10721.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508718825|gb|EOY10722.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 479 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFP++ELAH ALNLVNG Sbjct: 430 QEGRMRGQAFVTFPAVELAHHALNLVNG 457 >ref|XP_004230890.1| PREDICTED: RNA-binding protein 40-like isoform 1 [Solanum lycopersicum] Length = 448 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 340 SIVGICYFQEGRMRGQAFVTFPSIELAHDALNLVNG 447 S + + QEGRMRGQAFVTFPSIELA +ALNLVNG Sbjct: 391 SSLAVKLMQEGRMRGQAFVTFPSIELAQNALNLVNG 426 >ref|XP_003632078.1| PREDICTED: LOW QUALITY PROTEIN: RNA-binding protein 40-like [Vitis vinifera] Length = 463 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALN+VNG Sbjct: 414 QEGRMRGQAFVTFPSVELAHHALNVVNG 441 >emb|CBI36672.3| unnamed protein product [Vitis vinifera] Length = 263 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 364 QEGRMRGQAFVTFPSIELAHDALNLVNG 447 QEGRMRGQAFVTFPS+ELAH ALN+VNG Sbjct: 214 QEGRMRGQAFVTFPSVELAHHALNVVNG 241