BLASTX nr result
ID: Rauwolfia21_contig00021561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00021561 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 86 2e-19 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 67 3e-09 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 100 bits (250), Expect = 2e-19 Identities = 48/58 (82%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -2 Query: 307 MQLRGPLVGPDRWWYHTLLKETVRDTLASYGSVPESG-PPLSFDQRVLKPTCPPQSLP 137 MQLRGPLVGPDRWWYHTLLK TVRDTLASYGS PESG PP SFDQRVL+PT P P Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLEPTFPALDAP 58 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 85.9 bits (211), Expect(2) = 2e-19 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 273 GGGITPFSKKPYVTLSRHTAPSRNQDLPFPLTNGSSNQPVLP 148 GGGITPFSK+PYVTLSRHTAPSRN+DLPFPLTNGSSNQPV P Sbjct: 20 GGGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSSNQPVPP 61 Score = 35.0 bits (79), Expect(2) = 2e-19 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 88 FQVQALAVEASRQKRTSGQKR 26 FQVQALAVEASRQK TSG R Sbjct: 71 FQVQALAVEASRQKLTSGPGR 91 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 224 RESVTYGFFEKGVIPPPIRPDERSTELHPYSPG 322 RE++TYG FEKGV PPPIRPDERSTELHPYSPG Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSPG 912