BLASTX nr result
ID: Rauwolfia21_contig00021416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00021416 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69253.1| hypothetical protein M569_05511 [Genlisea aurea] 63 4e-08 ref|XP_002269109.2| PREDICTED: dnaJ homolog subfamily B member 1... 60 4e-07 ref|XP_002529542.1| heat shock protein binding protein, putative... 60 4e-07 emb|CBI23775.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_006847193.1| hypothetical protein AMTR_s00017p00249800 [A... 59 5e-07 gb|EPS59952.1| hypothetical protein M569_14852, partial [Genlise... 57 2e-06 ref|XP_006352130.1| PREDICTED: dnaJ protein homolog 1-like [Sola... 57 3e-06 ref|XP_004250740.1| PREDICTED: dnaJ protein homolog 1-like [Sola... 57 3e-06 ref|YP_001209726.1| chaperone protein DnaJ [Dichelobacter nodosu... 57 3e-06 gb|EPS40844.1| hypothetical protein H072_5291 [Dactylellina hapt... 56 4e-06 ref|XP_004036300.1| PREDICTED: dnaJ homolog subfamily B member 8... 55 1e-05 >gb|EPS69253.1| hypothetical protein M569_05511 [Genlisea aurea] Length = 257 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +2 Query: 128 NLYSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 N Y ILG+PKSA++ +I KAYK L ++W+P+RN SNK EAEA ++IN Sbjct: 11 NYYRILGIPKSATLSDICKAYKALVIKWHPDRNQSNKDEAEANFRSIN 58 >ref|XP_002269109.2| PREDICTED: dnaJ homolog subfamily B member 13-like [Vitis vinifera] Length = 259 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +2 Query: 128 NLYSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 + YSILG+ + ASI ++ KAYK L +W+P++N SNK EA+AK +AIN Sbjct: 11 DFYSILGISRGASILDVCKAYKSLAKKWHPDKNPSNKPEAQAKFQAIN 58 >ref|XP_002529542.1| heat shock protein binding protein, putative [Ricinus communis] gi|223530990|gb|EEF32845.1| heat shock protein binding protein, putative [Ricinus communis] Length = 257 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +2 Query: 128 NLYSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 + Y ILG+PKSAS+ ++SKAYK L +W+P++N SNK EA+ + + IN Sbjct: 11 DFYGILGIPKSASLKDVSKAYKSLVTKWHPDKNPSNKDEAQVQLQQIN 58 >emb|CBI23775.3| unnamed protein product [Vitis vinifera] Length = 316 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +2 Query: 128 NLYSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 + YSILG+ + ASI ++ KAYK L +W+P++N SNK EA+AK +AIN Sbjct: 11 DFYSILGISRGASILDVCKAYKSLAKKWHPDKNPSNKPEAQAKFQAIN 58 >ref|XP_006847193.1| hypothetical protein AMTR_s00017p00249800 [Amborella trichopoda] gi|548850222|gb|ERN08774.1| hypothetical protein AMTR_s00017p00249800 [Amborella trichopoda] Length = 335 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +2 Query: 134 YSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 YSIL LPK AS EI +AYK L MRW+P++N N+ EAEAK KAI+ Sbjct: 5 YSILLLPKDASDEEIRRAYKSLVMRWHPDKNPQNRLEAEAKFKAIS 50 >gb|EPS59952.1| hypothetical protein M569_14852, partial [Genlisea aurea] Length = 227 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +2 Query: 134 YSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAI 268 Y ILG+ K+A + EI KAYK L ++W+P++NT N+AEAEAK + I Sbjct: 122 YKILGVAKTAPVLEIKKAYKKLALQWHPDKNTENRAEAEAKFQEI 166 >ref|XP_006352130.1| PREDICTED: dnaJ protein homolog 1-like [Solanum tuberosum] Length = 347 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +2 Query: 134 YSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 Y IL +PKSAS+ +I KAYK L +W+P+RN SN+AEA K ++IN Sbjct: 15 YGILEIPKSASLKDICKAYKHLVKKWHPDRNKSNQAEAVDKFRSIN 60 >ref|XP_004250740.1| PREDICTED: dnaJ protein homolog 1-like [Solanum lycopersicum] Length = 344 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +2 Query: 134 YSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 Y IL +PKSAS+ +I KAYK L +W+P+RN SN+AEA K ++IN Sbjct: 15 YGILEIPKSASLKDICKAYKHLVKKWHPDRNKSNQAEAVDKFRSIN 60 >ref|YP_001209726.1| chaperone protein DnaJ [Dichelobacter nodosus VCS1703A] gi|500954075|ref|WP_012031150.1| molecular chaperone DnaJ [Dichelobacter nodosus] gi|189083317|sp|A5EYE5.1|DNAJ_DICNV RecName: Full=Chaperone protein DnaJ gi|146232940|gb|ABQ13918.1| chaperone protein DnaJ [Dichelobacter nodosus VCS1703A] Length = 374 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/48 (54%), Positives = 38/48 (79%) Frame = +2 Query: 128 NLYSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 +LY+ILG+ ++A+ EI KAY+ L+M+W+P+RN +NK EAE K K IN Sbjct: 5 DLYAILGVCRTANQDEIKKAYRKLSMKWHPDRNPNNKEEAEEKFKEIN 52 >gb|EPS40844.1| hypothetical protein H072_5291 [Dactylellina haptotyla CBS 200.50] Length = 369 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +2 Query: 134 YSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAI 268 YSILG+PKSAS +I KAYK L ++W+P+RN NK AE K K I Sbjct: 6 YSILGVPKSASEDDIKKAYKKLALKWHPDRNRDNKEGAEKKFKEI 50 >ref|XP_004036300.1| PREDICTED: dnaJ homolog subfamily B member 8 [Gorilla gorilla gorilla] Length = 232 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/48 (47%), Positives = 35/48 (72%) Frame = +2 Query: 128 NLYSILGLPKSASIYEISKAYKFLTMRWNPERNTSNKAEAEAKCKAIN 271 N Y +LG+ SAS+ +I KAY+ L +RW+P++N +NK EAE K K ++ Sbjct: 3 NYYEVLGVQASASLEDIKKAYRKLALRWHPDKNPNNKEEAEKKFKQVS 50