BLASTX nr result
ID: Rauwolfia21_contig00021362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00021362 (236 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367498.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 63 4e-08 ref|XP_004243986.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 6e-08 ref|XP_006346045.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 1e-07 ref|XP_006361327.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 1e-07 ref|XP_004252520.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 2e-07 ref|XP_002307193.2| hypothetical protein POPTR_0005s10020g [Popu... 59 7e-07 ref|XP_004294068.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 1e-06 ref|XP_002266085.2| PREDICTED: peptidyl-prolyl cis-trans isomera... 58 1e-06 emb|CBI21690.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAN74428.1| hypothetical protein VITISV_010985 [Vitis vinifera] 58 1e-06 gb|EPS58333.1| hypothetical protein M569_16482, partial [Genlise... 58 1e-06 gb|EMJ15843.1| hypothetical protein PRUPE_ppa001764mg [Prunus pe... 58 1e-06 gb|AAG51976.1|AC024260_14 hypothetical protein; 15173-12677 [Ara... 57 2e-06 ref|NP_175776.2| cyclophilin 59 [Arabidopsis thaliana] gi|456808... 57 2e-06 gb|AAL24306.1| Unknown protein [Arabidopsis thaliana] 57 2e-06 gb|EOY31963.1| Peptidyl-prolyl cis-trans isomerase-like 4 isofor... 57 3e-06 gb|EOY31962.1| Peptidyl-prolyl cis-trans isomerase-like 4 isofor... 57 3e-06 ref|XP_003554819.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 3e-06 ref|XP_003546644.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 57 3e-06 ref|XP_002891769.1| hypothetical protein ARALYDRAFT_474506 [Arab... 56 4e-06 >ref|XP_006367498.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum tuberosum] Length = 403 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSVMIVTSLGD+VVDLFTDRCPLTCKNFLK Sbjct: 1 MSVMIVTSLGDMVVDLFTDRCPLTCKNFLK 30 >ref|XP_004243986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum lycopersicum] Length = 587 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSVMIVTSLG+IV+DLFTDRCPLTCKNFLK Sbjct: 1 MSVMIVTSLGEIVIDLFTDRCPLTCKNFLK 30 >ref|XP_006346045.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum tuberosum] Length = 587 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSVMIVTSLG++V+DLFTDRCPLTCKNFLK Sbjct: 1 MSVMIVTSLGELVIDLFTDRCPLTCKNFLK 30 >ref|XP_006361327.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum tuberosum] Length = 383 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSVMIVTSLGD+VVDLFTD CPLTCKNFLK Sbjct: 1 MSVMIVTSLGDMVVDLFTDECPLTCKNFLK 30 >ref|XP_004252520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Solanum lycopersicum] Length = 382 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSVMIVTSLGD+V+DLFTD CPLTCKNFLK Sbjct: 1 MSVMIVTSLGDMVIDLFTDECPLTCKNFLK 30 >ref|XP_002307193.2| hypothetical protein POPTR_0005s10020g [Populus trichocarpa] gi|550338518|gb|EEE94189.2| hypothetical protein POPTR_0005s10020g [Populus trichocarpa] Length = 488 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIVVDL+ D+CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDIVVDLYADKCPLTCKNFLK 30 >ref|XP_004294068.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Fragaria vesca subsp. vesca] Length = 629 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIVVDL+TDRCPLT KNFLK Sbjct: 1 MSVLIVTSLGDIVVDLYTDRCPLTTKNFLK 30 >ref|XP_002266085.2| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Vitis vinifera] Length = 627 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIVVDL+TDRCPLT KNFLK Sbjct: 1 MSVLIVTSLGDIVVDLYTDRCPLTSKNFLK 30 >emb|CBI21690.3| unnamed protein product [Vitis vinifera] Length = 633 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIVVDL+TDRCPLT KNFLK Sbjct: 1 MSVLIVTSLGDIVVDLYTDRCPLTSKNFLK 30 >emb|CAN74428.1| hypothetical protein VITISV_010985 [Vitis vinifera] Length = 522 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIVVDL+TDRCPLT KNFLK Sbjct: 1 MSVLIVTSLGDIVVDLYTDRCPLTSKNFLK 30 >gb|EPS58333.1| hypothetical protein M569_16482, partial [Genlisea aurea] Length = 125 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSVMIVTSLGDI VDL DRCPLTCKNFLK Sbjct: 1 MSVMIVTSLGDITVDLHIDRCPLTCKNFLK 30 >gb|EMJ15843.1| hypothetical protein PRUPE_ppa001764mg [Prunus persica] Length = 768 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLG+IVVDL TD+CPLTCKNFLK Sbjct: 1 MSVLIVTSLGEIVVDLHTDKCPLTCKNFLK 30 >gb|AAG51976.1|AC024260_14 hypothetical protein; 15173-12677 [Arabidopsis thaliana] Length = 509 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIV+DL +D+CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDIVIDLHSDKCPLTCKNFLK 30 >ref|NP_175776.2| cyclophilin 59 [Arabidopsis thaliana] gi|45680880|gb|AAS75309.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase [Arabidopsis thaliana] gi|332194868|gb|AEE32989.1| cyclophilin 59 [Arabidopsis thaliana] Length = 506 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIV+DL +D+CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDIVIDLHSDKCPLTCKNFLK 30 >gb|AAL24306.1| Unknown protein [Arabidopsis thaliana] Length = 441 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIV+DL +D+CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDIVIDLHSDKCPLTCKNFLK 30 >gb|EOY31963.1| Peptidyl-prolyl cis-trans isomerase-like 4 isoform 2 [Theobroma cacao] Length = 642 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIV+DL+TD+CPLT KNFLK Sbjct: 1 MSVLIVTSLGDIVIDLYTDKCPLTSKNFLK 30 >gb|EOY31962.1| Peptidyl-prolyl cis-trans isomerase-like 4 isoform 1 [Theobroma cacao] Length = 593 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIV+DL+TD+CPLT KNFLK Sbjct: 1 MSVLIVTSLGDIVIDLYTDKCPLTSKNFLK 30 >ref|XP_003554819.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform X1 [Glycine max] Length = 640 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGD+VVDL T++CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDLVVDLHTNKCPLTCKNFLK 30 >ref|XP_003546644.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Glycine max] Length = 633 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGD+VVDL T++CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDLVVDLHTNKCPLTCKNFLK 30 >ref|XP_002891769.1| hypothetical protein ARALYDRAFT_474506 [Arabidopsis lyrata subsp. lyrata] gi|297337611|gb|EFH68028.1| hypothetical protein ARALYDRAFT_474506 [Arabidopsis lyrata subsp. lyrata] Length = 508 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +2 Query: 146 MSVMIVTSLGDIVVDLFTDRCPLTCKNFLK 235 MSV+IVTSLGDIV+DL+ ++CPLTCKNFLK Sbjct: 1 MSVLIVTSLGDIVIDLYPNKCPLTCKNFLK 30