BLASTX nr result
ID: Rauwolfia21_contig00021160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00021160 (341 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234224.1| dehydroascorbate reductase [Solanum lycopers... 59 5e-07 ref|NP_001275053.1| dehydroascorbate reductase [Solanum tuberosu... 58 1e-06 >ref|NP_001234224.1| dehydroascorbate reductase [Solanum lycopersicum] gi|66475038|gb|AAY47049.1| dehydroascorbate reductase [Solanum lycopersicum] Length = 268 Score = 59.3 bits (142), Expect = 5e-07 Identities = 41/77 (53%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Frame = +1 Query: 112 MSTAKITPSAAVVSTTIKHLTCNLNLQCPRVR-TVFTGPFNSTHSRRPRITRKGLRVAMS 288 MSTAKITPSAA +T+IKHL +Q PR + T+FT NST R P R+G V+M Sbjct: 1 MSTAKITPSAASFATSIKHLA---GIQLPRRQSTIFTS--NSTKFRAP---RRGFTVSM- 51 Query: 289 TSASRSDPLEVCVKESV 339 +AS PLEVCVK+S+ Sbjct: 52 -AASIETPLEVCVKQSI 67 >ref|NP_001275053.1| dehydroascorbate reductase [Solanum tuberosum] gi|123187087|gb|ABM69253.1| dehydroascorbate reductase [Solanum tuberosum] gi|215794047|gb|ACJ70069.1| dehydroascorbate reductase [Solanum tuberosum] Length = 268 Score = 57.8 bits (138), Expect = 1e-06 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = +1 Query: 112 MSTAKITPSAAVVSTTIKHLTCNLNLQCPRVR-TVFTGPFNSTHSRRPRITRKGLRVAMS 288 MSTAKITPSAA +T+IKHL +Q PR++ T++T NST R PR +S Sbjct: 1 MSTAKITPSAASFATSIKHLA---GIQLPRLQNTIYTS--NSTKFRAPR-----RAFTVS 50 Query: 289 TSASRSDPLEVCVKESV 339 +AS PLEVCVK+S+ Sbjct: 51 MAASLDTPLEVCVKQSI 67