BLASTX nr result
ID: Rauwolfia21_contig00020995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00020995 (870 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS49728.1| Quinone oxidoreductase PIG3 [Triticum urartu] 58 5e-06 >gb|EMS49728.1| Quinone oxidoreductase PIG3 [Triticum urartu] Length = 248 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 191 NCNKMQVHGGSSGIGTFAIQIAKYCGVKVFVTAG 90 N ++ ++HGGSSGIGTFAIQIAK+ GVKVFVTAG Sbjct: 62 NASRTKIHGGSSGIGTFAIQIAKHLGVKVFVTAG 95