BLASTX nr result
ID: Rauwolfia21_contig00020635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00020635 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530166.1| conserved hypothetical protein [Ricinus comm... 62 8e-08 ref|XP_002323401.2| hypothetical protein POPTR_0016s07430g [Popu... 61 1e-07 ref|XP_006430106.1| hypothetical protein CICLE_v10013147mg [Citr... 60 4e-07 ref|XP_002309400.2| hypothetical protein POPTR_0006s22230g [Popu... 60 4e-07 >ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis] gi|223530327|gb|EEF32221.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 216 TMSRRRGNVPKLDLKLNLSPPRANPRVQSPSRSET 320 TMSRR GN PKLDLKLNLSPPRA+PRV+SP+RS T Sbjct: 86 TMSRRNGNGPKLDLKLNLSPPRADPRVESPNRSAT 120 >ref|XP_002323401.2| hypothetical protein POPTR_0016s07430g [Populus trichocarpa] gi|550321046|gb|EEF05162.2| hypothetical protein POPTR_0016s07430g [Populus trichocarpa] Length = 144 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 201 KEAAATMSRRRGNVPKLDLKLNLSPPRANPRVQSPSRSET 320 K + MSRR G++PKLDLKLNLSPPR NPRV+SP RS T Sbjct: 24 KNKTSRMSRRNGSLPKLDLKLNLSPPRVNPRVESPGRSAT 63 >ref|XP_006430106.1| hypothetical protein CICLE_v10013147mg [Citrus clementina] gi|557532163|gb|ESR43346.1| hypothetical protein CICLE_v10013147mg [Citrus clementina] Length = 115 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 219 MSRRRGNVPKLDLKLNLSPPRANPRVQSPSRSET 320 MSRR GNVPKLDLKLNLSPPR NP ++SPS+S T Sbjct: 1 MSRRNGNVPKLDLKLNLSPPRGNPHMESPSQSAT 34 >ref|XP_002309400.2| hypothetical protein POPTR_0006s22230g [Populus trichocarpa] gi|550336847|gb|EEE92923.2| hypothetical protein POPTR_0006s22230g [Populus trichocarpa] Length = 113 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 219 MSRRRGNVPKLDLKLNLSPPRANPRVQSPSRSET 320 MSRR G++PKLDLKLNLSPPR NPRV+SP RS T Sbjct: 1 MSRRNGSLPKLDLKLNLSPPRVNPRVESPGRSAT 34