BLASTX nr result
ID: Rauwolfia21_contig00020485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00020485 (319 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510549.1| Zeamatin precursor, putative [Ricinus commun... 59 7e-07 >ref|XP_002510549.1| Zeamatin precursor, putative [Ricinus communis] gi|223551250|gb|EEF52736.1| Zeamatin precursor, putative [Ricinus communis] Length = 325 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 116 VYITFIFLLLFITGISGATLTLINRCNHVVWPGILANA 3 +YIT I L+ F G+SGAT TLINRC + VWPGILANA Sbjct: 10 LYITLITLIAFCRGVSGATFTLINRCGYTVWPGILANA 47