BLASTX nr result
ID: Rauwolfia21_contig00019453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00019453 (281 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348619.1| PREDICTED: uncharacterized protein LOC102602... 65 9e-09 ref|XP_004253455.1| PREDICTED: uncharacterized protein LOC101245... 65 9e-09 ref|XP_002514531.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_006844190.1| hypothetical protein AMTR_s00006p00263990 [A... 60 3e-07 gb|EOY01481.1| Uncharacterized protein isoform 1 [Theobroma cacao] 60 3e-07 ref|XP_004964328.1| PREDICTED: uncharacterized protein LOC101785... 58 1e-06 gb|EMJ28722.1| hypothetical protein PRUPE_ppa011886mg [Prunus pe... 58 1e-06 ref|NP_001046704.1| Os02g0326000 [Oryza sativa Japonica Group] g... 58 1e-06 ref|XP_003571222.1| PREDICTED: uncharacterized protein LOC100830... 58 1e-06 gb|EEC73053.1| hypothetical protein OsI_07007 [Oryza sativa Indi... 58 1e-06 ref|XP_006484370.1| PREDICTED: uncharacterized protein LOC102610... 58 1e-06 ref|XP_006484369.1| PREDICTED: uncharacterized protein LOC102610... 58 1e-06 ref|XP_006484368.1| PREDICTED: uncharacterized protein LOC102610... 58 1e-06 ref|XP_006437783.1| hypothetical protein CICLE_v10032286mg [Citr... 58 1e-06 gb|EPS74596.1| hypothetical protein M569_00157, partial [Genlise... 58 1e-06 ref|XP_003631234.1| PREDICTED: uncharacterized protein LOC100256... 57 2e-06 emb|CBI27125.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002436357.1| hypothetical protein SORBIDRAFT_10g000990 [S... 57 2e-06 ref|XP_002279949.1| PREDICTED: uncharacterized protein LOC100256... 57 2e-06 ref|XP_004487399.1| PREDICTED: uncharacterized protein LOC101504... 57 3e-06 >ref|XP_006348619.1| PREDICTED: uncharacterized protein LOC102602378 [Solanum tuberosum] Length = 290 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LL+NCA FV LLH+ YA+F TK+GMKA+LRLPRWLA AI Sbjct: 252 LLINCAFFVSLLHLLYAIFLTKFGMKANLRLPRWLAIAI 290 >ref|XP_004253455.1| PREDICTED: uncharacterized protein LOC101245935, partial [Solanum lycopersicum] Length = 177 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LL+NCA FV LLH+ YA+F TK+GMKA+LRLPRWLA AI Sbjct: 139 LLINCAFFVSLLHLLYAIFLTKFGMKANLRLPRWLAIAI 177 >ref|XP_002514531.1| conserved hypothetical protein [Ricinus communis] gi|223546135|gb|EEF47637.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN SFVFLLH+ Y+VFFT+ GMK SLRLPRWL A+ Sbjct: 267 VLLNSGSFVFLLHLLYSVFFTRLGMKDSLRLPRWLEKAL 305 >ref|XP_006844190.1| hypothetical protein AMTR_s00006p00263990 [Amborella trichopoda] gi|548846589|gb|ERN05865.1| hypothetical protein AMTR_s00006p00263990 [Amborella trichopoda] Length = 294 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLNC FVFLLH+ YAVF ++ GMK SL LPRWL AI Sbjct: 256 LLLNCGFFVFLLHVLYAVFLSRLGMKVSLSLPRWLEKAI 294 >gb|EOY01481.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 293 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN ASFVFLLH+ Y+VF T+ GMKASLRLP WL AI Sbjct: 255 VLLNSASFVFLLHLLYSVFLTRMGMKASLRLPGWLEKAI 293 >ref|XP_004964328.1| PREDICTED: uncharacterized protein LOC101785237 [Setaria italica] Length = 289 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLNCA FVFLLH+ Y VF TK G+K SLR PRWL + + Sbjct: 251 LLLNCAFFVFLLHVLYTVFLTKLGIKPSLRPPRWLDNVL 289 >gb|EMJ28722.1| hypothetical protein PRUPE_ppa011886mg [Prunus persica] Length = 192 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +L+N SF+FLLH+ Y+VF T+ GMK+SLRLPRWL AI Sbjct: 154 VLINSGSFMFLLHLLYSVFLTRLGMKSSLRLPRWLEKAI 192 >ref|NP_001046704.1| Os02g0326000 [Oryza sativa Japonica Group] gi|46390264|dbj|BAD15693.1| unknown protein [Oryza sativa Japonica Group] gi|113536235|dbj|BAF08618.1| Os02g0326000 [Oryza sativa Japonica Group] gi|215736884|dbj|BAG95813.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765527|dbj|BAG87224.1| unnamed protein product [Oryza sativa Japonica Group] gi|222622737|gb|EEE56869.1| hypothetical protein OsJ_06502 [Oryza sativa Japonica Group] Length = 281 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLNC F+FLLHI Y +F TK G+K SLR PRWL AI Sbjct: 243 LLLNCGFFIFLLHIMYTIFLTKLGIKPSLRPPRWLDKAI 281 >ref|XP_003571222.1| PREDICTED: uncharacterized protein LOC100830022 [Brachypodium distachyon] Length = 295 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWL 177 LLLNC FVF+LHI Y +F TK G+K SLRLPRWL Sbjct: 238 LLLNCGFFVFILHIIYTIFLTKLGIKPSLRLPRWL 272 >gb|EEC73053.1| hypothetical protein OsI_07007 [Oryza sativa Indica Group] Length = 281 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLNC F+FLLHI Y +F TK G+K SLR PRWL AI Sbjct: 243 LLLNCGFFIFLLHIMYTIFLTKLGIKPSLRPPRWLDKAI 281 >ref|XP_006484370.1| PREDICTED: uncharacterized protein LOC102610092 isoform X3 [Citrus sinensis] Length = 264 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN FVFLLH+ Y+VF T+ GMKASLRLPRWL A+ Sbjct: 226 VLLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 264 >ref|XP_006484369.1| PREDICTED: uncharacterized protein LOC102610092 isoform X2 [Citrus sinensis] Length = 280 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN FVFLLH+ Y+VF T+ GMKASLRLPRWL A+ Sbjct: 242 VLLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 280 >ref|XP_006484368.1| PREDICTED: uncharacterized protein LOC102610092 isoform X1 [Citrus sinensis] Length = 291 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN FVFLLH+ Y+VF T+ GMKASLRLPRWL A+ Sbjct: 253 VLLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 291 >ref|XP_006437783.1| hypothetical protein CICLE_v10032286mg [Citrus clementina] gi|557539979|gb|ESR51023.1| hypothetical protein CICLE_v10032286mg [Citrus clementina] Length = 291 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN FVFLLH+ Y+VF T+ GMKASLRLPRWL A+ Sbjct: 253 VLLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 291 >gb|EPS74596.1| hypothetical protein M569_00157, partial [Genlisea aurea] Length = 227 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLAS 171 LL+NCA+FVFLLH+ YAV F K G K+ +RLP+WL S Sbjct: 191 LLINCATFVFLLHVLYAVLFAKLGKKSEIRLPKWLDS 227 >ref|XP_003631234.1| PREDICTED: uncharacterized protein LOC100256033 isoform 2 [Vitis vinifera] Length = 140 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLN FVFLLHI YAVF ++ GMKASL +PRWL AI Sbjct: 102 LLLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 140 >emb|CBI27125.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLN FVFLLHI YAVF ++ GMKASL +PRWL AI Sbjct: 154 LLLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 192 >ref|XP_002436357.1| hypothetical protein SORBIDRAFT_10g000990 [Sorghum bicolor] gi|241914580|gb|EER87724.1| hypothetical protein SORBIDRAFT_10g000990 [Sorghum bicolor] Length = 286 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 28/39 (71%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LL NCA FVFLLHI Y VF TK G+K SLR PRWL I Sbjct: 248 LLFNCAFFVFLLHIMYTVFLTKLGIKPSLRPPRWLDKVI 286 >ref|XP_002279949.1| PREDICTED: uncharacterized protein LOC100256033 isoform 1 [Vitis vinifera] Length = 286 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 LLLN FVFLLHI YAVF ++ GMKASL +PRWL AI Sbjct: 248 LLLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 286 >ref|XP_004487399.1| PREDICTED: uncharacterized protein LOC101504306 [Cicer arietinum] gi|502091416|ref|XP_004489544.1| PREDICTED: uncharacterized protein LOC101513327 [Cicer arietinum] Length = 289 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 281 LLLNCASFVFLLHIFYAVFFTKYGMKASLRLPRWLASAI 165 +LLN F+FLLH+ Y+VF T+ GMKASL+LPRWL AI Sbjct: 251 VLLNSGCFMFLLHMLYSVFLTRMGMKASLKLPRWLEKAI 289