BLASTX nr result
ID: Rauwolfia21_contig00019095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00019095 (593 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW22823.1| hypothetical protein PHAVU_005G184200g [Phaseolus... 92 1e-16 ref|XP_002299164.1| predicted protein [Populus trichocarpa] 91 3e-16 gb|ABK96444.1| unknown [Populus trichocarpa x Populus deltoides] 91 3e-16 ref|XP_006493446.1| PREDICTED: uncharacterized protein LOC102619... 87 3e-15 ref|XP_006385951.1| hypothetical protein POPTR_0003s18640g [Popu... 87 3e-15 ref|XP_002512777.1| conserved hypothetical protein [Ricinus comm... 87 3e-15 ref|XP_002303969.1| predicted protein [Populus trichocarpa] 87 3e-15 ref|XP_006427699.1| hypothetical protein CICLE_v10026849mg [Citr... 86 6e-15 gb|AFK46042.1| unknown [Lotus japonicus] 85 2e-14 ref|XP_003637290.1| hypothetical protein MTR_080s0045 [Medicago ... 85 2e-14 ref|XP_002269716.1| PREDICTED: uncharacterized protein LOC100255... 82 8e-14 gb|EMJ19069.1| hypothetical protein PRUPE_ppa021322mg, partial [... 82 1e-13 gb|EXC14087.1| hypothetical protein L484_004412 [Morus notabilis] 79 1e-12 ref|XP_004137647.1| PREDICTED: uncharacterized protein LOC101215... 75 2e-11 ref|XP_004487210.1| PREDICTED: uncharacterized protein LOC101489... 74 3e-11 ref|XP_006366270.1| PREDICTED: uncharacterized protein LOC102582... 67 3e-09 ref|XP_004241669.1| PREDICTED: uncharacterized protein LOC101254... 66 6e-09 emb|CBW30212.1| Conserved hypothetical protein [Musa balbisiana] 65 2e-08 emb|CBW30174.1| Conserved hypothetical protein [Musa balbisiana] 65 2e-08 ref|XP_002510114.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 >gb|ESW22823.1| hypothetical protein PHAVU_005G184200g [Phaseolus vulgaris] Length = 132 Score = 92.0 bits (227), Expect = 1e-16 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAGLLKL+DD+QTCGYEDVQVMWEML RTES+ + H KRK PFWR+FVW Sbjct: 68 GAGLLKLQDDVQTCGYEDVQVMWEMLQRTESDVVENHHKRKQLPFWRIFVW 118 >ref|XP_002299164.1| predicted protein [Populus trichocarpa] Length = 92 Score = 90.5 bits (223), Expect = 3e-16 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GA LLKL +D+QTCGYEDVQVMWE+L R+ESE M+ H KRK RPFWRVFVW Sbjct: 28 GANLLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKRKQRPFWRVFVW 78 >gb|ABK96444.1| unknown [Populus trichocarpa x Populus deltoides] Length = 92 Score = 90.5 bits (223), Expect = 3e-16 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GA LLKL +D+QTCGYEDVQVMWE+L R+ESE M+ H KRK RPFWRVFVW Sbjct: 28 GANLLKLHNDVQTCGYEDVQVMWEILRRSESELMASHPKRKQRPFWRVFVW 78 >ref|XP_006493446.1| PREDICTED: uncharacterized protein LOC102619868 [Citrus sinensis] Length = 92 Score = 87.0 bits (214), Expect = 3e-15 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAG+LKLRDD+QTC Y+DVQVMWEMLSR+ESE ++ + KR+ RPFWRV VW Sbjct: 28 GAGILKLRDDVQTCEYQDVQVMWEMLSRSESEMINHNPKRRQRPFWRVLVW 78 >ref|XP_006385951.1| hypothetical protein POPTR_0003s18640g [Populus trichocarpa] gi|550343476|gb|ERP63748.1| hypothetical protein POPTR_0003s18640g [Populus trichocarpa] Length = 144 Score = 87.0 bits (214), Expect = 3e-15 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAGLL+L +D+QTCGYEDVQVMWE+L R+ESE M+ KRK RPFWRVFVW Sbjct: 80 GAGLLELHNDVQTCGYEDVQVMWEILRRSESELMASLPKRKQRPFWRVFVW 130 >ref|XP_002512777.1| conserved hypothetical protein [Ricinus communis] gi|223547788|gb|EEF49280.1| conserved hypothetical protein [Ricinus communis] Length = 92 Score = 87.0 bits (214), Expect = 3e-15 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAGLLKLR+D+QTCGYEDVQVMWEML R+ESE ++ ++KRK R FWR VW Sbjct: 28 GAGLLKLRNDVQTCGYEDVQVMWEMLRRSESEQIANYSKRKQRSFWRALVW 78 >ref|XP_002303969.1| predicted protein [Populus trichocarpa] Length = 90 Score = 87.0 bits (214), Expect = 3e-15 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAGLL+L +D+QTCGYEDVQVMWE+L R+ESE M+ KRK RPFWRVFVW Sbjct: 26 GAGLLELHNDVQTCGYEDVQVMWEILRRSESELMASLPKRKQRPFWRVFVW 76 >ref|XP_006427699.1| hypothetical protein CICLE_v10026849mg [Citrus clementina] gi|557529689|gb|ESR40939.1| hypothetical protein CICLE_v10026849mg [Citrus clementina] Length = 92 Score = 86.3 bits (212), Expect = 6e-15 Identities = 37/51 (72%), Positives = 45/51 (88%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAG+LKLRDD+QTC Y+DVQVMWEMLSR+ESE ++ + KR+ RPFWRV VW Sbjct: 28 GAGILKLRDDVQTCEYQDVQVMWEMLSRSESEMINHNPKRRQRPFWRVSVW 78 >gb|AFK46042.1| unknown [Lotus japonicus] Length = 157 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 GAGLLKL+DD+QTCGY DVQVMWE+L RTESE + KRK PFWR+FVW Sbjct: 92 GAGLLKLQDDVQTCGYSDVQVMWEILQRTESEVIDKCHKRKQLPFWRIFVW 142 >ref|XP_003637290.1| hypothetical protein MTR_080s0045 [Medicago truncatula] gi|355503225|gb|AES84428.1| hypothetical protein MTR_080s0045 [Medicago truncatula] Length = 161 Score = 84.7 bits (208), Expect = 2e-14 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFV 444 GAGL+KL+DD+QTCGYEDVQVMWEML +TE+E + H KRK PFWR+FV Sbjct: 95 GAGLVKLQDDVQTCGYEDVQVMWEMLQKTETELVDNHHKRKQLPFWRLFV 144 >ref|XP_002269716.1| PREDICTED: uncharacterized protein LOC100255236 [Vitis vinifera] gi|298204741|emb|CBI25239.3| unnamed protein product [Vitis vinifera] Length = 93 Score = 82.4 bits (202), Expect = 8e-14 Identities = 38/52 (73%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEM-LSRTESESMSGHAKRKHRPFWRVFVW 441 G GLLKL DD+QTC Y+DV MW M LSR+ESE S H KRKHRPFWRVFVW Sbjct: 28 GGGLLKLHDDVQTCEYDDVHRMWNMMLSRSESEHGSQHTKRKHRPFWRVFVW 79 >gb|EMJ19069.1| hypothetical protein PRUPE_ppa021322mg, partial [Prunus persica] Length = 78 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVF 447 GAGLLKL DD+QTCGY+DVQVMW+MLSR ++E S H+KRK RPFWRVF Sbjct: 14 GAGLLKLHDDVQTCGYQDVQVMWQMLSR-DTELTSHHSKRKQRPFWRVF 61 >gb|EXC14087.1| hypothetical protein L484_004412 [Morus notabilis] Length = 95 Score = 78.6 bits (192), Expect = 1e-12 Identities = 37/57 (64%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGH------AKRKHRPFWRVFVW 441 GAGLLKL DD+Q CGY+DVQVMWEML R+ESE ++GH + K RPFW VFVW Sbjct: 25 GAGLLKLHDDVQMCGYQDVQVMWEMLQRSESE-LNGHNHENHPKRNKQRPFWSVFVW 80 >ref|XP_004137647.1| PREDICTED: uncharacterized protein LOC101215661 [Cucumis sativus] Length = 103 Score = 74.7 bits (182), Expect = 2e-11 Identities = 30/50 (60%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -1 Query: 587 GLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGH-AKRKHRPFWRVFVW 441 GLLKL DD++TCGY+DV+VMWE+L R+E+E ++ H +RKH+PFW+ VW Sbjct: 30 GLLKLHDDVETCGYQDVKVMWEILRRSEAELINHHQMRRKHKPFWKALVW 79 >ref|XP_004487210.1| PREDICTED: uncharacterized protein LOC101489986 [Cicer arietinum] Length = 179 Score = 73.9 bits (180), Expect = 3e-11 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESE-SMSGHAKRKHRPFWRVF 447 GAGLLKL+DD+QTC YEDVQVMWEML + E++ + H KRK PFWRVF Sbjct: 118 GAGLLKLQDDVQTCEYEDVQVMWEMLHKNETQVTEHNHHKRKQLPFWRVF 167 >ref|XP_006366270.1| PREDICTED: uncharacterized protein LOC102582729 [Solanum tuberosum] Length = 74 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRK 471 GAGLLKL+ DIQ+CGYEDVQVMWEML TESE S H KRK Sbjct: 29 GAGLLKLQGDIQSCGYEDVQVMWEMLGGTESELTSRHIKRK 69 >ref|XP_004241669.1| PREDICTED: uncharacterized protein LOC101254501 [Solanum lycopersicum] Length = 120 Score = 66.2 bits (160), Expect = 6e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRK 471 GAGLLKL+ DIQ+CGYEDVQVMWEML T+SE S H KRK Sbjct: 75 GAGLLKLQGDIQSCGYEDVQVMWEMLGGTDSELTSRHIKRK 115 >emb|CBW30212.1| Conserved hypothetical protein [Musa balbisiana] Length = 107 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 G G+ KL DD+Q CGY+DVQVMWEM+ R+E E +S KR+ R WR+ W Sbjct: 45 GGGIQKLHDDVQMCGYQDVQVMWEMVRRSEME-LSNERKRRKRLLWRIPTW 94 >emb|CBW30174.1| Conserved hypothetical protein [Musa balbisiana] Length = 108 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = -1 Query: 593 GAGLLKLRDDIQTCGYEDVQVMWEMLSRTESESMSGHAKRKHRPFWRVFVW 441 G G+ KL DD+Q CGY+DVQVMWEM+ R+E E +S KR+ R WR+ W Sbjct: 46 GGGIQKLHDDVQMCGYQDVQVMWEMVRRSEME-LSNERKRRKRLLWRIPTW 95 >ref|XP_002510114.1| conserved hypothetical protein [Ricinus communis] gi|223550815|gb|EEF52301.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 63.9 bits (154), Expect = 3e-08 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = -1 Query: 587 GLLKLRDDIQTCGYEDVQVMWEMLSRTESES--MSGHAKRKHRPFWRVFVW 441 GLLKLR D++ C YEDV++MWEML RTE+ES S K K R FW+ F W Sbjct: 28 GLLKLRHDVRACEYEDVRIMWEMLRRTETESARQSQPVKSKKRCFWKCFSW 78