BLASTX nr result
ID: Rauwolfia21_contig00018363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00018363 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P27608.1|AROF_TOBAC RecName: Full=Phospho-2-dehydro-3-deoxyhe... 72 1e-10 emb|CAA75092.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synt... 72 1e-10 gb|EOY15957.1| Class-II DAHP synthetase family protein isoform 1... 71 2e-10 ref|XP_006363279.1| PREDICTED: uncharacterized LOC102577618 [Sol... 70 2e-10 ref|NP_001234418.1| phospho-2-dehydro-3-deoxyheptonate aldolase ... 70 2e-10 ref|XP_002869212.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate ... 70 2e-10 emb|CBI19189.3| unnamed protein product [Vitis vinifera] 70 2e-10 ref|NP_001268096.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate ... 70 2e-10 gb|EXC09685.1| Phospho-2-dehydro-3-deoxyheptonate aldolase 1 [Mo... 70 3e-10 emb|CAA75386.1| 2-dehydro-3-deoxyphosphoheptonate aldolase [Mori... 70 3e-10 emb|CBI29448.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002531676.1| Phospho-2-dehydro-3-deoxyheptonate aldolase ... 70 3e-10 ref|NP_001268127.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate ... 70 3e-10 ref|XP_002307072.2| hypothetical protein POPTR_0005s07450g [Popu... 69 6e-10 ref|XP_004288179.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonat... 69 6e-10 sp|P21357.2|AROF_SOLTU RecName: Full=Phospho-2-dehydro-3-deoxyhe... 69 6e-10 ref|XP_006472576.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonat... 69 8e-10 ref|XP_006466251.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonat... 69 8e-10 ref|XP_006433947.1| hypothetical protein CICLE_v10000835mg [Citr... 69 8e-10 ref|XP_006426356.1| hypothetical protein CICLE_v10025342mg [Citr... 69 8e-10 >sp|P27608.1|AROF_TOBAC RecName: Full=Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic; AltName: Full=3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 1; AltName: Full=DAHP synthase 1; AltName: Full=Phospho-2-keto-3-deoxyheptonate aldolase 1; Flags: Precursor gi|170225|gb|AAA34068.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase [Nicotiana tabacum] gi|228697|prf||1808327A deoxyheptulosonate phosphate synthase Length = 542 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQ L Sbjct: 505 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQNVL 540 >emb|CAA75092.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase [Morinda citrifolia] Length = 535 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRRLGS K+L Sbjct: 498 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSPKSL 533 >gb|EOY15957.1| Class-II DAHP synthetase family protein isoform 1 [Theobroma cacao] Length = 539 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+ SQK+L Sbjct: 500 YHTHCDPRLNASQSLELAFIIAERLRKRRISSQKSL 535 >ref|XP_006363279.1| PREDICTED: uncharacterized LOC102577618 [Solanum tuberosum] Length = 541 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLEL+FIIAERLRKRRLGSQ L Sbjct: 504 YHTHCDPRLNASQSLELSFIIAERLRKRRLGSQSVL 539 >ref|NP_001234418.1| phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic [Solanum lycopersicum] gi|584778|sp|P37216.1|AROG_SOLLC RecName: Full=Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic; AltName: Full=3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 2; AltName: Full=DAHP synthase 2; AltName: Full=Phospho-2-keto-3-deoxyheptonate aldolase 2; Flags: Precursor gi|410488|emb|CAA79856.1| phospho-2-dehydro-3-deoxyheptonate aldolase [Solanum lycopersicum] Length = 541 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLEL+FIIAERLRKRRLGSQ L Sbjct: 504 YHTHCDPRLNASQSLELSFIIAERLRKRRLGSQSTL 539 >ref|XP_002869212.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase [Arabidopsis lyrata subsp. lyrata] gi|297315048|gb|EFH45471.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase [Arabidopsis lyrata subsp. lyrata] Length = 505 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKALI 224 YHTHCDPRLNASQSLELAFIIAERLRKRRLGS K+ I Sbjct: 467 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSGKSSI 503 >emb|CBI19189.3| unnamed protein product [Vitis vinifera] Length = 370 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+GSQ +L Sbjct: 330 YHTHCDPRLNASQSLELAFIIAERLRKRRIGSQLSL 365 >ref|NP_001268096.1| 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 02 [Vitis vinifera] gi|262181539|gb|ACY29660.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase 02 [Vitis vinifera] Length = 548 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+GSQ +L Sbjct: 508 YHTHCDPRLNASQSLELAFIIAERLRKRRIGSQLSL 543 >gb|EXC09685.1| Phospho-2-dehydro-3-deoxyheptonate aldolase 1 [Morus notabilis] Length = 532 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+G+Q+ L Sbjct: 493 YHTHCDPRLNASQSLELAFIIAERLRKRRMGTQRLL 528 >emb|CAA75386.1| 2-dehydro-3-deoxyphosphoheptonate aldolase [Morinda citrifolia] Length = 535 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQK 233 YHTHCDPRLNASQSLELAFIIAERLRKRR+GSQ+ Sbjct: 499 YHTHCDPRLNASQSLELAFIIAERLRKRRMGSQR 532 >emb|CBI29448.3| unnamed protein product [Vitis vinifera] Length = 369 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+G+Q+ L Sbjct: 330 YHTHCDPRLNASQSLELAFIIAERLRKRRMGTQRLL 365 >ref|XP_002531676.1| Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplast precursor, putative [Ricinus communis] gi|223528707|gb|EEF30720.1| Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplast precursor, putative [Ricinus communis] Length = 533 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+G+Q+ L Sbjct: 494 YHTHCDPRLNASQSLELAFIIAERLRKRRIGTQRLL 529 >ref|NP_001268127.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase [Vitis vinifera] gi|222136861|gb|ACM45080.1| 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase 01 [Vitis vinifera] Length = 532 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+G+Q+ L Sbjct: 493 YHTHCDPRLNASQSLELAFIIAERLRKRRMGTQRLL 528 >ref|XP_002307072.2| hypothetical protein POPTR_0005s07450g [Populus trichocarpa] gi|550338327|gb|EEE94068.2| hypothetical protein POPTR_0005s07450g [Populus trichocarpa] Length = 531 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQK 233 YHTHCDPRLNASQSLELAFIIAERLRKRR+G+Q+ Sbjct: 492 YHTHCDPRLNASQSLELAFIIAERLRKRRIGTQR 525 >ref|XP_004288179.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 534 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQ+LELAFIIAERLRKRR+G+Q+ L Sbjct: 495 YHTHCDPRLNASQALELAFIIAERLRKRRIGTQRLL 530 >sp|P21357.2|AROF_SOLTU RecName: Full=Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic; AltName: Full=3-deoxy-D-arabino-heptulosonate 7-phosphate synthase 1; AltName: Full=DAHP synthase 1; AltName: Full=Phospho-2-keto-3-deoxyheptonate aldolase 1; Flags: Precursor Length = 538 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQ 236 YHTHCDPRLNASQSLEL+FIIAERLRKRRLGSQ Sbjct: 504 YHTHCDPRLNASQSLELSFIIAERLRKRRLGSQ 536 >ref|XP_006472576.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic-like [Citrus sinensis] Length = 527 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+ SQ+ L Sbjct: 486 YHTHCDPRLNASQSLELAFIIAERLRKRRISSQQPL 521 >ref|XP_006466251.1| PREDICTED: phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic-like [Citrus sinensis] Length = 531 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQK 233 YHTHCDPRLNASQSLELAFIIAERLRK+RLG+Q+ Sbjct: 492 YHTHCDPRLNASQSLELAFIIAERLRKKRLGTQR 525 >ref|XP_006433947.1| hypothetical protein CICLE_v10000835mg [Citrus clementina] gi|557536069|gb|ESR47187.1| hypothetical protein CICLE_v10000835mg [Citrus clementina] Length = 527 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQKAL 227 YHTHCDPRLNASQSLELAFIIAERLRKRR+ SQ+ L Sbjct: 486 YHTHCDPRLNASQSLELAFIIAERLRKRRISSQQPL 521 >ref|XP_006426356.1| hypothetical protein CICLE_v10025342mg [Citrus clementina] gi|557528346|gb|ESR39596.1| hypothetical protein CICLE_v10025342mg [Citrus clementina] Length = 531 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 334 YHTHCDPRLNASQSLELAFIIAERLRKRRLGSQK 233 YHTHCDPRLNASQSLELAFIIAERLRK+RLG+Q+ Sbjct: 492 YHTHCDPRLNASQSLELAFIIAERLRKKRLGTQR 525