BLASTX nr result
ID: Rauwolfia21_contig00016276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00016276 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_190233.2| oxidoreductase, 2OG-Fe(II) oxygenase family pro... 48 1e-06 ref|XP_002875784.1| hypothetical protein ARALYDRAFT_905837 [Arab... 47 2e-06 ref|XP_006279035.1| hypothetical protein CARUB_v10016550mg, part... 47 2e-06 ref|XP_002875786.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 46 4e-06 emb|CAB62319.1| putative protein [Arabidopsis thaliana] 45 6e-06 >ref|NP_190233.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis thaliana] gi|332644644|gb|AEE78165.1| iron ion binding / oxidoreductase/ oxidoreductase protein [Arabidopsis thaliana] Length = 330 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = +3 Query: 189 WQIPFFVTPGYDYVVECLPTCQSIDNPPKY 278 + IPFF+ P +D ++ECLPTCQS +N PKY Sbjct: 278 YSIPFFLKPSHDCIIECLPTCQSENNLPKY 307 Score = 30.4 bits (67), Expect(2) = 1e-06 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 2 LHRVLGNGQERFSVRLVKFFFK 67 LHRVLGNGQ+R+S + FF K Sbjct: 267 LHRVLGNGQDRYS---IPFFLK 285 >ref|XP_002875784.1| hypothetical protein ARALYDRAFT_905837 [Arabidopsis lyrata subsp. lyrata] gi|297321622|gb|EFH52043.1| hypothetical protein ARALYDRAFT_905837 [Arabidopsis lyrata subsp. lyrata] Length = 162 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +3 Query: 189 WQIPFFVTPGYDYVVECLPTCQSIDNPPKYV 281 + IPFF+ P +D ++ECLP CQS +N PKY+ Sbjct: 98 YSIPFFLKPSHDCIIECLPNCQSENNLPKYI 128 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 2 LHRVLGNGQERFSVRLVKFFFK 67 LHRVLGNGQ+R+S + FF K Sbjct: 87 LHRVLGNGQDRYS---IPFFLK 105 >ref|XP_006279035.1| hypothetical protein CARUB_v10016550mg, partial [Capsella rubella] gi|482547402|gb|EOA11933.1| hypothetical protein CARUB_v10016550mg, partial [Capsella rubella] Length = 278 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = +3 Query: 189 WQIPFFVTPGYDYVVECLPTCQSIDNPPKY 278 + IPFF+ P +D ++ECLPTCQ+ +N PKY Sbjct: 242 YSIPFFLKPSHDCIIECLPTCQNENNLPKY 271 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 2 LHRVLGNGQERFSVRLVKFFFK 67 LHRVLGNGQ+R+S + FF K Sbjct: 231 LHRVLGNGQDRYS---IPFFLK 249 >ref|XP_002875786.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297321624|gb|EFH52045.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 331 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = +3 Query: 189 WQIPFFVTPGYDYVVECLPTCQSIDNPPKY 278 + IPFF+ P +D ++ECLP CQS +N PKY Sbjct: 279 YSIPFFLKPSHDCIIECLPNCQSENNLPKY 308 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 2 LHRVLGNGQERFSVRLVKFFFK 67 LHRVLGNGQ+R+S + FF K Sbjct: 268 LHRVLGNGQDRYS---IPFFLK 286 >emb|CAB62319.1| putative protein [Arabidopsis thaliana] Length = 306 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +3 Query: 189 WQIPFFVTPGYDYVVECLPTCQSIDNPPK 275 + IPFF+ P +D ++ECLPTCQS +N PK Sbjct: 278 YSIPFFLKPSHDCIIECLPTCQSENNLPK 306 Score = 30.4 bits (67), Expect(2) = 6e-06 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 2 LHRVLGNGQERFSVRLVKFFFK 67 LHRVLGNGQ+R+S + FF K Sbjct: 267 LHRVLGNGQDRYS---IPFFLK 285