BLASTX nr result
ID: Rauwolfia21_contig00015807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00015807 (392 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243487.1| PREDICTED: cellulose synthase-like protein B... 59 7e-07 >ref|XP_004243487.1| PREDICTED: cellulose synthase-like protein B3-like [Solanum lycopersicum] Length = 743 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 7 WAMRSIFEVCYAVLPAFCILNNTYFLPKVN 96 WA+RSIFEVCYA+LPA+C++ N+YFLPK N Sbjct: 541 WALRSIFEVCYAILPAYCLITNSYFLPKAN 570