BLASTX nr result
ID: Rauwolfia21_contig00014441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00014441 (692 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38573.1| hypothetical protein L484_008601 [Morus notabilis] 56 9e-06 >gb|EXB38573.1| hypothetical protein L484_008601 [Morus notabilis] Length = 95 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/83 (40%), Positives = 45/83 (54%), Gaps = 2/83 (2%) Frame = +2 Query: 170 LHLLVPLLAFSYFFPFNAVATSRTMHLLHENQ--EIPAFKDTKQIATXXXXXXXXXXFGN 343 L +LV +L FS+ NAV +R L+H NQ ++P KQ+ T Sbjct: 8 LQVLVIVLCFSHLIFSNAVPVTRIRGLMHGNQAHDLPQGTIHKQVTTEKILEEKTVA--- 64 Query: 344 RRMDFQSIDYPGSGANDRHTPRP 412 RMD + DYPGSGAN+RHTP+P Sbjct: 65 ERMDVELHDYPGSGANNRHTPKP 87