BLASTX nr result
ID: Rauwolfia21_contig00014334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00014334 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC13109.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 gb|EXB30863.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-06 >gb|EXC13109.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus notabilis] Length = 316 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/44 (68%), Positives = 33/44 (75%) Frame = -1 Query: 133 RIQRLIHDGPLGSLRLEE*PQCESCLMGKMTKRSFTQKTERAKE 2 RI+RLI DGPL L++ E P ESCL GKMTKR FT K ERAKE Sbjct: 220 RIERLIKDGPLRQLKVGEHPVGESCLEGKMTKRHFTAKGERAKE 263 >gb|EXB30863.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus notabilis] Length = 403 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 130 IQRLIHDGPLGSLRLEE*PQCESCLMGKMTKRSFTQKTERAKE 2 IQRL++DGPL L++ P CESCL GKMTKR FT K ERA E Sbjct: 97 IQRLVNDGPLSELKVGGLPVCESCLEGKMTKRPFTAKGERATE 139