BLASTX nr result
ID: Rauwolfia21_contig00013034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00013034 (538 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG34874.1|AF261020_2 putative chloroplast RNA helicase VDL i... 55 8e-06 >gb|AAG34874.1|AF261020_2 putative chloroplast RNA helicase VDL isoform 2 [Nicotiana tabacum] gi|11385592|gb|AAG34877.1|AF261022_1 putative chloroplast RNA helicase VDL isoform 2 [Nicotiana tabacum] Length = 132 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 2 MEEVGYVLPTNVQMQSLPLLFSGRDCVLQAQV 97 +EEVGYV+PT VQ+Q+LP L+SGRDCVL AQV Sbjct: 82 VEEVGYVIPTEVQLQALPFLYSGRDCVLHAQV 113