BLASTX nr result
ID: Rauwolfia21_contig00012718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00012718 (660 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24896.1| hypothetical protein L484_011762 [Morus notabilis] 60 8e-07 ref|XP_002523743.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >gb|EXC24896.1| hypothetical protein L484_011762 [Morus notabilis] Length = 132 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/88 (38%), Positives = 44/88 (50%) Frame = +1 Query: 91 LEQISLEEDDHQEEPKHSDSHEEYYHCCRTPRRQEQKIPPIQSCXXXXXXXXXXXXXXXX 270 LEQ+S+ D +E+ EYY C+TP ++QKIP QSC Sbjct: 42 LEQLSVLSTDREEQKL------EYYDDCKTPTSEDQKIPTTQSCPPTPRKPASDRVFLRK 95 Query: 271 XWADELQFFEYTGRDEVESFLKSCSEFS 354 E FFE TGR+EVESF +S +FS Sbjct: 96 RKFSEFHFFESTGREEVESFFRSTFKFS 123 >ref|XP_002523743.1| conserved hypothetical protein [Ricinus communis] gi|223537047|gb|EEF38683.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 59.3 bits (142), Expect = 1e-06 Identities = 35/96 (36%), Positives = 47/96 (48%), Gaps = 1/96 (1%) Frame = +1 Query: 82 DHALEQISL-EEDDHQEEPKHSDSHEEYYHCCRTPRRQEQKIPPIQSCXXXXXXXXXXXX 258 DH L+ + ED HQ + H H+E C+TP + KIP IQ+C Sbjct: 36 DHELQVHEVPSEDHHQHQHHHHHHHQEEEEECKTPTSSDHKIPSIQTCPPTPRKKAHKSF 95 Query: 259 XXXXXWADELQFFEYTGRDEVESFLKSCSEFSRVSS 366 EL+FFE + +DEV+SF +S E SRV S Sbjct: 96 LHKRK-LPELEFFEASNKDEVDSFFRSNFEMSRVES 130