BLASTX nr result
ID: Rauwolfia21_contig00011440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011440 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303351.1| PREDICTED: uncharacterized protein LOC101311... 55 1e-05 >ref|XP_004303351.1| PREDICTED: uncharacterized protein LOC101311394 isoform 1 [Fragaria vesca subsp. vesca] gi|470135067|ref|XP_004303352.1| PREDICTED: uncharacterized protein LOC101311394 isoform 2 [Fragaria vesca subsp. vesca] Length = 158 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/47 (63%), Positives = 32/47 (68%) Frame = -2 Query: 370 GYALPKFTQLTVTXXXXXXXXXXYCISLLTRQIEQTHSSRPQHERLR 230 GYALPKF QLTVT Y ISLLTR IE+TH+SR Q ERLR Sbjct: 112 GYALPKFAQLTVTSYYATSSASHYGISLLTRHIEETHTSRSQQERLR 158