BLASTX nr result
ID: Rauwolfia21_contig00011164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011164 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chlo... 56 6e-06 >ref|XP_006359224.1| PREDICTED: 50S ribosomal protein L19-2, chloroplastic-like [Solanum tuberosum] Length = 222 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = -2 Query: 164 MGSNVLPQALYMVPRSQAGCAPAKKLGFSALISRCPSSFNSSALSVSRVL 15 MGS VLPQAL++VPR+ C +KL FSA +SR PS N S S SR+L Sbjct: 1 MGSIVLPQALFVVPRNPTRCTTPQKLAFSACVSRRPSQLNVSLFSASRLL 50