BLASTX nr result
ID: Rauwolfia21_contig00011147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00011147 (771 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|22... 59 2e-06 >ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|223533641|gb|EEF35378.1| catalytic, putative [Ricinus communis] Length = 526 Score = 58.9 bits (141), Expect = 2e-06 Identities = 31/62 (50%), Positives = 37/62 (59%) Frame = -1 Query: 675 KL**EFSVEKFNGSCRLQFFSRWCWAYLSSTFLTKPHILRAGALFGAMALVGFPAFYCVR 496 KL EFS++KF +CRL FF+RW WAYL+ FLT L L A A+ GF Y VR Sbjct: 461 KLPKEFSLQKFRRTCRLHFFARWVWAYLTGGFLTGCKKLNKPKLLIAGAMAGFAVVYSVR 520 Query: 495 NK 490 K Sbjct: 521 YK 522