BLASTX nr result
ID: Rauwolfia21_contig00008275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00008275 (684 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 93 7e-17 gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 86 1e-14 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 72 2e-10 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 43 3e-06 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = -2 Query: 683 WEEPLPSCLIREASIHLRRLKVLSEPCWIVTHHTALKPNLWWIPGDKV 540 WEEPL SCLI ASIH RRLKVLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 6 WEEPLLSCLIVGASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 85.5 bits (210), Expect = 1e-14 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = +3 Query: 516 MGQRIKRFDFVSRDPPQVGFESRVMGDYPARFGEHF*SAQVNGS 647 MGQRIKRFDFVSRD PQVGFESRVMGDYPARFGEHF SA VNGS Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGS 44 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +3 Query: 516 MGQRIKRFDFVSRDPPQVGFESRVMGDYPARFGE 617 MGQRIKRFDFVSRD PQVGFESRVMGDYPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/67 (52%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -2 Query: 683 WEEPLPSCLIREASIHLRRLKVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLR 507 ++ L S L R SI RLKVL EPC I+T++T GD VKALDPLPHTL+ Sbjct: 6 YKNSLLSYLTRGPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLK 65 Query: 506 CSSPPIK 486 SS PIK Sbjct: 66 GSSTPIK 72 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 43.1 bits (100), Expect(3) = 3e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -1 Query: 507 MFLPADQGH*GRDRLFFKPLSFGSDKSSPFAQ 412 M LPA RDRL FKPLSFGSDKSSPF + Sbjct: 1 MLLPASDA--ARDRLSFKPLSFGSDKSSPFGR 30 Score = 28.5 bits (62), Expect(3) = 3e-06 Identities = 14/22 (63%), Positives = 17/22 (77%), Gaps = 2/22 (9%) Frame = -2 Query: 416 LRWSS--LIFPNVQSCSDLRDE 357 +RWSS + FPNV+SCS LR E Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKE 55 Score = 25.4 bits (54), Expect(3) = 3e-06 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 361 MRKEHRPSAMNE 326 +RKEHRPS +NE Sbjct: 52 LRKEHRPSTLNE 63