BLASTX nr result
ID: Rauwolfia21_contig00005258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00005258 (500 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 154 1e-35 gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus pe... 154 1e-35 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 153 2e-35 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 153 2e-35 gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase fam... 153 3e-35 gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase fam... 153 3e-35 gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus... 152 3e-35 gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlise... 152 3e-35 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 152 4e-35 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 152 4e-35 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 152 4e-35 ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-proly... 151 8e-35 ref|XP_002512679.1| fk506-binding protein, putative [Ricinus com... 149 4e-34 ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Popu... 149 5e-34 gb|ESW11191.1| hypothetical protein PHAVU_008G009400g [Phaseolus... 148 8e-34 ref|XP_006286545.1| hypothetical protein CARUB_v10001775mg [Caps... 148 8e-34 ref|XP_003621051.1| Peptidyl-prolyl cis-trans isomerase-like pro... 148 8e-34 dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] 147 1e-33 ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans is... 147 1e-33 ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyra... 147 2e-33 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 154 bits (389), Expect = 1e-35 Identities = 75/81 (92%), Positives = 79/81 (97%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 KIGSQEVIPAFEEAVSGM+LGG+RRIIVPPELGYPEND+NK GPRPTTFSGQRALDFVLR Sbjct: 160 KIGSQEVIPAFEEAVSGMSLGGVRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLR 219 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIEL+KII N Sbjct: 220 NQGLIDKTLLFDIELMKIIPN 240 >gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] Length = 262 Score = 154 bits (389), Expect = 1e-35 Identities = 75/81 (92%), Positives = 79/81 (97%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPEND+NK GPRPTTFSGQRALDFVLR Sbjct: 182 RVGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLR 241 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIEL+KII N Sbjct: 242 NQGLIDKTLLFDIELIKIIPN 262 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 153 bits (387), Expect = 2e-35 Identities = 77/81 (95%), Positives = 77/81 (95%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 KIG EVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNK GPRPTTFSGQRALDFVLR Sbjct: 162 KIGYNEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLR 221 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 222 NQGLIDKTLLFDIELLKIIPN 242 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 153 bits (387), Expect = 2e-35 Identities = 77/81 (95%), Positives = 77/81 (95%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 KIG EVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNK GPRPTTFSGQRALDFVLR Sbjct: 161 KIGYNEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLR 220 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 221 NQGLIDKTLLFDIELLKIIPN 241 >gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 255 Score = 153 bits (386), Expect = 3e-35 Identities = 76/81 (93%), Positives = 78/81 (96%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQEVIPAFEEAVSGMALGGIRRIIVPPELGYP NDFNK GPRPTTFSGQRALDFVLR Sbjct: 175 RLGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPGNDFNKSGPRPTTFSGQRALDFVLR 234 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 235 NQGLIDKTLLFDIELLKIIPN 255 >gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 249 Score = 153 bits (386), Expect = 3e-35 Identities = 76/81 (93%), Positives = 78/81 (96%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQEVIPAFEEAVSGMALGGIRRIIVPPELGYP NDFNK GPRPTTFSGQRALDFVLR Sbjct: 169 RLGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPGNDFNKSGPRPTTFSGQRALDFVLR 228 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 229 NQGLIDKTLLFDIELLKIIPN 249 >gb|EXB62019.1| Peptidyl-prolyl cis-trans isomerase FKBP19 [Morus notabilis] Length = 350 Score = 152 bits (385), Expect = 3e-35 Identities = 75/81 (92%), Positives = 78/81 (96%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQEVIPAFEEAVS MALGGIRRIIVPPELGYPENDFNK GPRPTTFSGQRALDFVL+ Sbjct: 270 RVGSQEVIPAFEEAVSSMALGGIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLK 329 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 330 NQGLIDKTLLFDIELLKIIPN 350 >gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlisea aurea] Length = 196 Score = 152 bits (385), Expect = 3e-35 Identities = 74/80 (92%), Positives = 78/80 (97%) Frame = +3 Query: 6 IGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN 185 +GS EVIPAFEEAVSGMA+GG+RRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN Sbjct: 114 LGSHEVIPAFEEAVSGMAVGGVRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN 173 Query: 186 QGLIDKTLLFDIELLKIILN 245 QGLIDKTLLFDIELLKI+ N Sbjct: 174 QGLIDKTLLFDIELLKILPN 193 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 152 bits (384), Expect = 4e-35 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQ+VIPAFEEAVSGMALGG+RRIIVPPE+GYPEND+NK GPRPTTFSGQRALDFVLR Sbjct: 187 RLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLR 246 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 247 NQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 152 bits (384), Expect = 4e-35 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQ+VIPAFEEAVSGMALGG+RRIIVPPE+GYPEND+NK GPRPTTFSGQRALDFVLR Sbjct: 170 RLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLR 229 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 230 NQGLIDKTLLFDIELLKIIPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 152 bits (384), Expect = 4e-35 Identities = 73/81 (90%), Positives = 79/81 (97%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQ+VIPAFEEAVSGMALGG+RRIIVPPE+GYPEND+NK GPRPTTFSGQRALDFVLR Sbjct: 187 RLGSQDVIPAFEEAVSGMALGGVRRIIVPPEIGYPENDYNKSGPRPTTFSGQRALDFVLR 246 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 247 NQGLIDKTLLFDIELLKIIPN 267 >ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 151 bits (382), Expect = 8e-35 Identities = 74/81 (91%), Positives = 78/81 (96%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GSQ+VIPAFEEAVSGM+LG IRRIIVPPELGYPENDFNK GPRPTTFSGQRALDFVLR Sbjct: 177 RVGSQQVIPAFEEAVSGMSLGSIRRIIVPPELGYPENDFNKSGPRPTTFSGQRALDFVLR 236 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKII N Sbjct: 237 NQGLIDKTLLFDIELLKIIPN 257 >ref|XP_002512679.1| fk506-binding protein, putative [Ricinus communis] gi|223548640|gb|EEF50131.1| fk506-binding protein, putative [Ricinus communis] Length = 246 Score = 149 bits (376), Expect = 4e-34 Identities = 72/79 (91%), Positives = 76/79 (96%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 K+GS EVIPAFEEAVSGM LGG+RRIIVPPELGYPENDFN+ GPRPTTFSGQRALDFVLR Sbjct: 166 KLGSGEVIPAFEEAVSGMTLGGVRRIIVPPELGYPENDFNRSGPRPTTFSGQRALDFVLR 225 Query: 183 NQGLIDKTLLFDIELLKII 239 NQGLIDKTLLFDIELLKI+ Sbjct: 226 NQGLIDKTLLFDIELLKIL 244 >ref|XP_002297882.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] gi|550347126|gb|EEE82687.2| hypothetical protein POPTR_0001s12920g [Populus trichocarpa] Length = 245 Score = 149 bits (375), Expect = 5e-34 Identities = 72/79 (91%), Positives = 77/79 (97%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 ++GS+EVIPAFEEAVSGMA GGIRRIIVPPELGYPEND+NK GPRPTTFSGQRALDFVLR Sbjct: 165 RLGSREVIPAFEEAVSGMAPGGIRRIIVPPELGYPENDYNKSGPRPTTFSGQRALDFVLR 224 Query: 183 NQGLIDKTLLFDIELLKII 239 NQGLIDKTLLFDIELLK+I Sbjct: 225 NQGLIDKTLLFDIELLKVI 243 >gb|ESW11191.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] Length = 274 Score = 148 bits (373), Expect = 8e-34 Identities = 73/81 (90%), Positives = 76/81 (93%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 KIG EVIPAFEEAVSGMALGGIRRIIVPPE+GYPENDFN+ PRPTTFSGQRALDFVLR Sbjct: 194 KIGYNEVIPAFEEAVSGMALGGIRRIIVPPEIGYPENDFNRGAPRPTTFSGQRALDFVLR 253 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIELLKI+ N Sbjct: 254 NQGLIDKTLLFDIELLKIVPN 274 >ref|XP_006286545.1| hypothetical protein CARUB_v10001775mg [Capsella rubella] gi|482555251|gb|EOA19443.1| hypothetical protein CARUB_v10001775mg [Capsella rubella] Length = 256 Score = 148 bits (373), Expect = 8e-34 Identities = 71/80 (88%), Positives = 76/80 (95%) Frame = +3 Query: 6 IGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN 185 +GS EVIPAFEEAVSGMALGGIRRIIVPPELGYP+ND+NK GPRP TFSGQRALDFVLRN Sbjct: 177 LGSNEVIPAFEEAVSGMALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRN 236 Query: 186 QGLIDKTLLFDIELLKIILN 245 QGLIDKTLLFD+ELLKI+ N Sbjct: 237 QGLIDKTLLFDVELLKIVQN 256 >ref|XP_003621051.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|355496066|gb|AES77269.1| Peptidyl-prolyl cis-trans isomerase-like protein [Medicago truncatula] gi|388505130|gb|AFK40631.1| unknown [Medicago truncatula] Length = 240 Score = 148 bits (373), Expect = 8e-34 Identities = 71/81 (87%), Positives = 78/81 (96%) Frame = +3 Query: 3 KIGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLR 182 K+GS EVIPAFEEAV+GM+LGGIRRIIVPPELGYPE+D+NK GPRPTTFSGQRALDFVLR Sbjct: 160 KVGSHEVIPAFEEAVAGMSLGGIRRIIVPPELGYPESDYNKGGPRPTTFSGQRALDFVLR 219 Query: 183 NQGLIDKTLLFDIELLKIILN 245 NQGLIDKTLLFDIEL+KI+ N Sbjct: 220 NQGLIDKTLLFDIELMKIVPN 240 >dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] Length = 255 Score = 147 bits (372), Expect = 1e-33 Identities = 71/80 (88%), Positives = 76/80 (95%) Frame = +3 Query: 6 IGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN 185 +GS EVIPAFEEAVSGMALGGIRRIIVPPELGYP+ND+NK GPRP TFSGQRALDFVLRN Sbjct: 176 LGSNEVIPAFEEAVSGMALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRN 235 Query: 186 QGLIDKTLLFDIELLKIILN 245 QGLIDKTLLFD+ELLKI+ N Sbjct: 236 QGLIDKTLLFDVELLKIVPN 255 >ref|NP_196845.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] gi|75335665|sp|Q9LYR5.1|FKB19_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic; Short=PPIase FKBP19; AltName: Full=FK506-binding protein 19; Short=AtFKBP19; AltName: Full=Immunophilin FKBP19; AltName: Full=Rotamase; Flags: Precursor gi|7543908|emb|CAB87148.1| putative protein [Arabidopsis thaliana] gi|46931302|gb|AAT06455.1| At5g13410 [Arabidopsis thaliana] gi|222423171|dbj|BAH19563.1| AT5G13410 [Arabidopsis thaliana] gi|332004508|gb|AED91891.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase 7 [Arabidopsis thaliana] Length = 256 Score = 147 bits (372), Expect = 1e-33 Identities = 71/80 (88%), Positives = 76/80 (95%) Frame = +3 Query: 6 IGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN 185 +GS EVIPAFEEAVSGMALGGIRRIIVPPELGYP+ND+NK GPRP TFSGQRALDFVLRN Sbjct: 177 LGSNEVIPAFEEAVSGMALGGIRRIIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRN 236 Query: 186 QGLIDKTLLFDIELLKIILN 245 QGLIDKTLLFD+ELLKI+ N Sbjct: 237 QGLIDKTLLFDVELLKIVPN 256 >ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297319447|gb|EFH49869.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 147 bits (370), Expect = 2e-33 Identities = 70/80 (87%), Positives = 76/80 (95%) Frame = +3 Query: 6 IGSQEVIPAFEEAVSGMALGGIRRIIVPPELGYPENDFNKKGPRPTTFSGQRALDFVLRN 185 +GS EVIPAFEEAVSGMALGGIRR+IVPPELGYP+ND+NK GPRP TFSGQRALDFVLRN Sbjct: 177 LGSNEVIPAFEEAVSGMALGGIRRLIVPPELGYPDNDYNKSGPRPMTFSGQRALDFVLRN 236 Query: 186 QGLIDKTLLFDIELLKIILN 245 QGLIDKTLLFD+ELLKI+ N Sbjct: 237 QGLIDKTLLFDVELLKIVPN 256