BLASTX nr result
ID: Rauwolfia21_contig00004193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00004193 (374 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486677.1| PREDICTED: DCC family protein At1g52590, chl... 60 2e-07 dbj|BAJ53228.1| JHL06P13.8 [Jatropha curcas] 60 3e-07 emb|CBI36301.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_002517615.1| nucleic acid binding protein, putative [Rici... 60 3e-07 ref|XP_002269416.1| PREDICTED: DCC family protein At1g52590, chl... 60 3e-07 ref|XP_006427254.1| hypothetical protein CICLE_v10026597mg [Citr... 59 7e-07 ref|XP_006427253.1| hypothetical protein CICLE_v10026597mg [Citr... 59 7e-07 ref|XP_006427252.1| hypothetical protein CICLE_v10026597mg [Citr... 59 7e-07 gb|EMJ16270.1| hypothetical protein PRUPE_ppa012374mg [Prunus pe... 59 7e-07 ref|NP_564611.1| putative thiol-disulfide oxidoreductase DCC [Ar... 59 7e-07 gb|AAM65780.1| unknown [Arabidopsis thaliana] 59 7e-07 ref|XP_002894389.1| hypothetical protein ARALYDRAFT_474385 [Arab... 58 1e-06 gb|EXB67313.1| hypothetical protein L484_025795 [Morus notabilis] 58 1e-06 ref|XP_006465348.1| PREDICTED: DCC family protein At1g52590, chl... 58 1e-06 gb|EPS71143.1| hypothetical protein M569_03618, partial [Genlise... 58 1e-06 ref|XP_004236013.1| PREDICTED: DCC family protein At1g52590, chl... 58 1e-06 ref|XP_006380216.1| hypothetical protein POPTR_0008s23020g [Popu... 57 2e-06 ref|XP_002328612.1| predicted protein [Populus trichocarpa] 57 2e-06 gb|ABQ42096.1| putative thioldisulphide oxidoreductase DCC [Sonn... 57 2e-06 gb|ABQ42095.1| putative thioldisulphide oxidoreductase DCC [Sonn... 57 2e-06 >ref|XP_004486677.1| PREDICTED: DCC family protein At1g52590, chloroplastic-like [Cicer arietinum] Length = 170 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 229 ITILNFRSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 + + N RS IKSEAVLKIMEYIDLPFPQLAF L+FVP Sbjct: 107 VLVENHRSYIKSEAVLKIMEYIDLPFPQLAFLLQFVP 143 >dbj|BAJ53228.1| JHL06P13.8 [Jatropha curcas] Length = 178 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 118 RSYIKSEAVLKIMEYIDLPFPQLAFFLQFVP 148 >emb|CBI36301.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 60 RSYIKSEAVLKIMEYIDLPFPQLAFFLQFVP 90 >ref|XP_002517615.1| nucleic acid binding protein, putative [Ricinus communis] gi|223543247|gb|EEF44779.1| nucleic acid binding protein, putative [Ricinus communis] Length = 180 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 115 RSYIKSEAVLKIMEYIDLPFPQLAFFLQFVP 145 >ref|XP_002269416.1| PREDICTED: DCC family protein At1g52590, chloroplastic [Vitis vinifera] Length = 176 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 117 RSYIKSEAVLKIMEYIDLPFPQLAFFLQFVP 147 >ref|XP_006427254.1| hypothetical protein CICLE_v10026597mg [Citrus clementina] gi|557529244|gb|ESR40494.1| hypothetical protein CICLE_v10026597mg [Citrus clementina] Length = 175 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKS+AVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 117 RSYIKSDAVLKIMEYIDLPFPQLAFFLQFVP 147 >ref|XP_006427253.1| hypothetical protein CICLE_v10026597mg [Citrus clementina] gi|557529243|gb|ESR40493.1| hypothetical protein CICLE_v10026597mg [Citrus clementina] Length = 177 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKS+AVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 117 RSYIKSDAVLKIMEYIDLPFPQLAFFLQFVP 147 >ref|XP_006427252.1| hypothetical protein CICLE_v10026597mg [Citrus clementina] gi|557529242|gb|ESR40492.1| hypothetical protein CICLE_v10026597mg [Citrus clementina] Length = 174 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKS+AVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 114 RSYIKSDAVLKIMEYIDLPFPQLAFFLQFVP 144 >gb|EMJ16270.1| hypothetical protein PRUPE_ppa012374mg [Prunus persica] Length = 172 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAV+KIMEYIDLPFPQLAFFL+FVP Sbjct: 115 RSFIKSEAVVKIMEYIDLPFPQLAFFLQFVP 145 >ref|NP_564611.1| putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|75207555|sp|Q9SSR1.1|Y1259_ARATH RecName: Full=DCC family protein At1g52590, chloroplastic; Flags: Precursor gi|5903046|gb|AAD55605.1|AC008016_15 F6D8.19 [Arabidopsis thaliana] gi|26450069|dbj|BAC42154.1| unknown protein [Arabidopsis thaliana] gi|28827528|gb|AAO50608.1| unknown protein [Arabidopsis thaliana] gi|332194706|gb|AEE32827.1| putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] Length = 172 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 229 ITILNFRSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 + + N RS IKSEAVLKIM+YIDLPFPQLAFFL+F P Sbjct: 109 VLVENDRSYIKSEAVLKIMKYIDLPFPQLAFFLQFAP 145 >gb|AAM65780.1| unknown [Arabidopsis thaliana] Length = 172 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 229 ITILNFRSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 + + N RS IKSEAVLKIM+YIDLPFPQLAFFL+F P Sbjct: 109 VLVENDRSYIKSEAVLKIMKYIDLPFPQLAFFLQFAP 145 >ref|XP_002894389.1| hypothetical protein ARALYDRAFT_474385 [Arabidopsis lyrata subsp. lyrata] gi|297340231|gb|EFH70648.1| hypothetical protein ARALYDRAFT_474385 [Arabidopsis lyrata subsp. lyrata] Length = 172 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -2 Query: 229 ITILNFRSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 + + N RS IKSEAVLKIM+YIDLPFPQLAFF++F P Sbjct: 109 VLVENDRSYIKSEAVLKIMKYIDLPFPQLAFFIQFAP 145 >gb|EXB67313.1| hypothetical protein L484_025795 [Morus notabilis] Length = 178 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 208 SCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 S IKSEAVLKIMEYIDLPFPQLAFFL+FVP Sbjct: 122 SHIKSEAVLKIMEYIDLPFPQLAFFLQFVP 151 >ref|XP_006465348.1| PREDICTED: DCC family protein At1g52590, chloroplastic-like [Citrus sinensis] Length = 177 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKS+AVLKIM+YIDLPFPQLAFFL+FVP Sbjct: 117 RSYIKSDAVLKIMDYIDLPFPQLAFFLQFVP 147 >gb|EPS71143.1| hypothetical protein M569_03618, partial [Genlisea aurea] Length = 136 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLA FL+FVP Sbjct: 79 RSYIKSEAVLKIMEYIDLPFPQLALFLQFVP 109 >ref|XP_004236013.1| PREDICTED: DCC family protein At1g52590, chloroplastic-like [Solanum lycopersicum] Length = 183 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS +KSEAVLKIMEYI+LPFPQLAFFL+FVP Sbjct: 126 RSYVKSEAVLKIMEYINLPFPQLAFFLQFVP 156 >ref|XP_006380216.1| hypothetical protein POPTR_0008s23020g [Populus trichocarpa] gi|550333737|gb|ERP58013.1| hypothetical protein POPTR_0008s23020g [Populus trichocarpa] Length = 176 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLAFFL+ VP Sbjct: 116 RSHIKSEAVLKIMEYIDLPFPQLAFFLQIVP 146 >ref|XP_002328612.1| predicted protein [Populus trichocarpa] Length = 176 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 RS IKSEAVLKIMEYIDLPFPQLAFFL+ VP Sbjct: 116 RSHIKSEAVLKIMEYIDLPFPQLAFFLQIVP 146 >gb|ABQ42096.1| putative thioldisulphide oxidoreductase DCC [Sonneratia caseolaris] Length = 151 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 R+ IKS+AVLKIMEYIDLPFPQLAFFL+F+P Sbjct: 106 RAYIKSDAVLKIMEYIDLPFPQLAFFLQFIP 136 >gb|ABQ42095.1| putative thioldisulphide oxidoreductase DCC [Sonneratia alba] Length = 151 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 211 RSCIKSEAVLKIMEYIDLPFPQLAFFLKFVP 119 R+ IKS+AVLKIMEYIDLPFPQLAFFL+F+P Sbjct: 106 RAYIKSDAVLKIMEYIDLPFPQLAFFLQFIP 136