BLASTX nr result
ID: Rauwolfia21_contig00004184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00004184 (326 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHH33093.1| tocopherol-like n-methyltransferase, partial [Cat... 76 4e-12 gb|AHH33092.1| 16-hydroxy-2,3-dihydro-3-hydroxytabersonine n-met... 64 2e-08 gb|ADP00410.1| 16-methoxy-2,3-dihydrotabersonine N-methyltransfe... 64 2e-08 >gb|AHH33093.1| tocopherol-like n-methyltransferase, partial [Catharanthus roseus var. roseus] Length = 288 Score = 76.3 bits (186), Expect = 4e-12 Identities = 32/44 (72%), Positives = 43/44 (97%) Frame = +2 Query: 2 TWKGFTSLLMKGGWTAIKELLALRMMSKAADDGLLKFVAITCRK 133 TW+GFTSLLMKGGW+AIK +LA+++M+KAADDGLLKF+A+TC++ Sbjct: 245 TWRGFTSLLMKGGWSAIKVVLAVKVMAKAADDGLLKFMAVTCKE 288 >gb|AHH33092.1| 16-hydroxy-2,3-dihydro-3-hydroxytabersonine n-methyltransferase [Catharanthus roseus] Length = 289 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = +2 Query: 2 TWKGFTSLLMKGGWTAIKELLALRMMSKAADDGLLKFVAITCRKS 136 TWKGFTS+++KGGW AI + A+R+++KAA+DG+LKF +T RKS Sbjct: 244 TWKGFTSIVLKGGWRAINLINAVRLVAKAANDGILKFAVVTGRKS 288 >gb|ADP00410.1| 16-methoxy-2,3-dihydrotabersonine N-methyltransferase [Catharanthus roseus] Length = 295 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = +2 Query: 2 TWKGFTSLLMKGGWTAIKELLALRMMSKAADDGLLKFVAITCRKS 136 TWKGFTS+++KGGW AI + A+R+++KAA+DG+LKF +T RKS Sbjct: 250 TWKGFTSIVLKGGWRAINLINAVRLVAKAANDGILKFAVVTGRKS 294