BLASTX nr result
ID: Rauwolfia21_contig00003150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00003150 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232651.1| PREDICTED: uncharacterized protein LOC101260... 57 3e-06 ref|XP_002530560.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_004232651.1| PREDICTED: uncharacterized protein LOC101260596 [Solanum lycopersicum] Length = 270 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +1 Query: 163 WGREDMVGELFNKIQRDELKPGDHIYSW*HGYLCSHHG 276 W +M G L NKI +DELKPGDHIYSW + YL +HHG Sbjct: 7 WTMPEMAGILSNKIPQDELKPGDHIYSWRNAYLYAHHG 44 >ref|XP_002530560.1| conserved hypothetical protein [Ricinus communis] gi|223529898|gb|EEF31828.1| conserved hypothetical protein [Ricinus communis] Length = 266 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +1 Query: 181 VGELFNKIQRDELKPGDHIYSW*HGYLCSHHG 276 +G L N IQRDELKPGDHIYSW H Y+ +HHG Sbjct: 1 MGVLSNIIQRDELKPGDHIYSWRHAYIYAHHG 32