BLASTX nr result
ID: Rauwolfia21_contig00002002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00002002 (602 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN25502.1| unknown [Zea mays] gi|414886382|tpg|DAA62396.1| T... 64 3e-08 tpg|DAA62394.1| TPA: hypothetical protein ZEAMMB73_041236 [Zea m... 63 7e-08 ref|XP_002462706.1| hypothetical protein SORBIDRAFT_02g030550 [S... 63 7e-08 ref|XP_002321975.1| rhodanese-like domain-containing family prot... 63 7e-08 ref|NP_001149014.1| rhodanese-like domain containing protein [Ze... 63 7e-08 ref|XP_006413041.1| hypothetical protein EUTSA_v10026171mg [Eutr... 62 2e-07 ref|XP_006413040.1| hypothetical protein EUTSA_v10026171mg [Eutr... 62 2e-07 ref|XP_006660868.1| PREDICTED: rhodanese-like domain-containing ... 61 2e-07 ref|XP_006660867.1| PREDICTED: rhodanese-like domain-containing ... 61 2e-07 gb|ESW08470.1| hypothetical protein PHAVU_009G048400g [Phaseolus... 61 2e-07 ref|XP_002534640.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 ref|XP_002317802.2| rhodanese-like domain-containing family prot... 60 4e-07 ref|XP_002317801.2| rhodanese-like domain-containing family prot... 60 4e-07 gb|EMJ20044.1| hypothetical protein PRUPE_ppa010351mg [Prunus pe... 60 4e-07 gb|ABK96337.1| unknown [Populus trichocarpa x Populus deltoides] 60 4e-07 ref|XP_006491648.1| PREDICTED: rhodanese-like domain-containing ... 60 6e-07 ref|XP_006491647.1| PREDICTED: rhodanese-like domain-containing ... 60 6e-07 ref|XP_006441184.1| hypothetical protein CICLE_v10021946mg [Citr... 60 6e-07 ref|XP_006441183.1| hypothetical protein CICLE_v10021946mg [Citr... 60 6e-07 ref|XP_006441182.1| hypothetical protein CICLE_v10021946mg [Citr... 60 6e-07 >gb|ACN25502.1| unknown [Zea mays] gi|414886382|tpg|DAA62396.1| TPA: hypothetical protein ZEAMMB73_041236 [Zea mays] Length = 139 Score = 63.9 bits (154), Expect = 3e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKEV 506 VRSVDVKEALRLQKENNFVILDVRPEAEFKE+ Sbjct: 80 VRSVDVKEALRLQKENNFVILDVRPEAEFKEI 111 >tpg|DAA62394.1| TPA: hypothetical protein ZEAMMB73_041236 [Zea mays] Length = 169 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNFVILDVRPEAEFKE Sbjct: 80 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 110 >ref|XP_002462706.1| hypothetical protein SORBIDRAFT_02g030550 [Sorghum bicolor] gi|241926083|gb|EER99227.1| hypothetical protein SORBIDRAFT_02g030550 [Sorghum bicolor] Length = 228 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNFVILDVRPEAEFKE Sbjct: 79 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 109 >ref|XP_002321975.1| rhodanese-like domain-containing family protein [Populus trichocarpa] gi|222868971|gb|EEF06102.1| rhodanese-like domain-containing family protein [Populus trichocarpa] Length = 239 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNFVILDVRPEAEFKE Sbjct: 91 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 121 >ref|NP_001149014.1| rhodanese-like domain containing protein [Zea mays] gi|195610936|gb|ACG27298.1| rhodanese-like domain containing protein [Zea mays] gi|195624004|gb|ACG33832.1| rhodanese-like domain containing protein [Zea mays] gi|414886381|tpg|DAA62395.1| TPA: rhodanese-like domain containing protein [Zea mays] Length = 229 Score = 62.8 bits (151), Expect = 7e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNFVILDVRPEAEFKE Sbjct: 80 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 110 >ref|XP_006413041.1| hypothetical protein EUTSA_v10026171mg [Eutrema salsugineum] gi|557114211|gb|ESQ54494.1| hypothetical protein EUTSA_v10026171mg [Eutrema salsugineum] Length = 226 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNFVILDVRPEAE+KE Sbjct: 77 VRSVDVKEALRLQKENNFVILDVRPEAEYKE 107 >ref|XP_006413040.1| hypothetical protein EUTSA_v10026171mg [Eutrema salsugineum] gi|557114210|gb|ESQ54493.1| hypothetical protein EUTSA_v10026171mg [Eutrema salsugineum] Length = 188 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNFVILDVRPEAE+KE Sbjct: 77 VRSVDVKEALRLQKENNFVILDVRPEAEYKE 107 >ref|XP_006660868.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like isoform X2 [Oryza brachyantha] Length = 229 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNF ILDVRPEAEFKE Sbjct: 80 VRSVDVKEALRLQKENNFAILDVRPEAEFKE 110 >ref|XP_006660867.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like isoform X1 [Oryza brachyantha] Length = 260 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKENNF ILDVRPEAEFKE Sbjct: 111 VRSVDVKEALRLQKENNFAILDVRPEAEFKE 141 >gb|ESW08470.1| hypothetical protein PHAVU_009G048400g [Phaseolus vulgaris] Length = 234 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVD KEALRLQKENNFVILDVRPEAEFKE Sbjct: 86 VRSVDAKEALRLQKENNFVILDVRPEAEFKE 116 >ref|XP_002534640.1| conserved hypothetical protein [Ricinus communis] gi|223524858|gb|EEF27743.1| conserved hypothetical protein [Ricinus communis] Length = 235 Score = 61.2 bits (147), Expect = 2e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQ+ENNFVILDVRPEAEFKE Sbjct: 87 VRSVDVKEALRLQQENNFVILDVRPEAEFKE 117 >ref|XP_002317802.2| rhodanese-like domain-containing family protein [Populus trichocarpa] gi|550326243|gb|EEE96022.2| rhodanese-like domain-containing family protein [Populus trichocarpa] Length = 239 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKEN FVILDVRPEAEFKE Sbjct: 91 VRSVDVKEALRLQKENKFVILDVRPEAEFKE 121 >ref|XP_002317801.2| rhodanese-like domain-containing family protein [Populus trichocarpa] gi|550326242|gb|EEE96021.2| rhodanese-like domain-containing family protein [Populus trichocarpa] Length = 184 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKEN FVILDVRPEAEFKE Sbjct: 91 VRSVDVKEALRLQKENKFVILDVRPEAEFKE 121 >gb|EMJ20044.1| hypothetical protein PRUPE_ppa010351mg [Prunus persica] Length = 253 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKEN FVILDVRPEAEFKE Sbjct: 87 VRSVDVKEALRLQKENKFVILDVRPEAEFKE 117 >gb|ABK96337.1| unknown [Populus trichocarpa x Populus deltoides] Length = 239 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSVDVKEALRLQKEN FVILDVRPEAEFKE Sbjct: 91 VRSVDVKEALRLQKENKFVILDVRPEAEFKE 121 >ref|XP_006491648.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like isoform X2 [Citrus sinensis] gi|568877907|ref|XP_006491959.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like [Citrus sinensis] Length = 240 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSV+ KEALRLQKENNFVILDVRPEAEFKE Sbjct: 92 VRSVEAKEALRLQKENNFVILDVRPEAEFKE 122 >ref|XP_006491647.1| PREDICTED: rhodanese-like domain-containing protein 14, chloroplastic-like isoform X1 [Citrus sinensis] Length = 241 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSV+ KEALRLQKENNFVILDVRPEAEFKE Sbjct: 92 VRSVEAKEALRLQKENNFVILDVRPEAEFKE 122 >ref|XP_006441184.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] gi|557543446|gb|ESR54424.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] Length = 241 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSV+ KEALRLQKENNFVILDVRPEAEFKE Sbjct: 92 VRSVEAKEALRLQKENNFVILDVRPEAEFKE 122 >ref|XP_006441183.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] gi|557543445|gb|ESR54423.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] Length = 240 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSV+ KEALRLQKENNFVILDVRPEAEFKE Sbjct: 92 VRSVEAKEALRLQKENNFVILDVRPEAEFKE 122 >ref|XP_006441182.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] gi|557543444|gb|ESR54422.1| hypothetical protein CICLE_v10021946mg [Citrus clementina] Length = 172 Score = 59.7 bits (143), Expect = 6e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 601 VRSVDVKEALRLQKENNFVILDVRPEAEFKE 509 VRSV+ KEALRLQKENNFVILDVRPEAEFKE Sbjct: 92 VRSVEAKEALRLQKENNFVILDVRPEAEFKE 122