BLASTX nr result
ID: Rauwolfia21_contig00001782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00001782 (4474 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006338069.1| PREDICTED: AP-4 complex subunit mu-like isof... 60 7e-06 ref|XP_006338068.1| PREDICTED: AP-4 complex subunit mu-like isof... 60 7e-06 ref|XP_004237988.1| PREDICTED: AP-4 complex subunit mu-like [Sol... 60 7e-06 >ref|XP_006338069.1| PREDICTED: AP-4 complex subunit mu-like isoform X2 [Solanum tuberosum] Length = 450 Score = 60.5 bits (145), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 4472 YQNTQRGNITKEAGPVSMTFTIPMYNPSRLQVKF 4371 + GNITKEAGPVSMTFTIPMYNPSRLQVK+ Sbjct: 388 FSQESHGNITKEAGPVSMTFTIPMYNPSRLQVKY 421 >ref|XP_006338068.1| PREDICTED: AP-4 complex subunit mu-like isoform X1 [Solanum tuberosum] Length = 452 Score = 60.5 bits (145), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 4472 YQNTQRGNITKEAGPVSMTFTIPMYNPSRLQVKF 4371 + GNITKEAGPVSMTFTIPMYNPSRLQVK+ Sbjct: 390 FSQESHGNITKEAGPVSMTFTIPMYNPSRLQVKY 423 >ref|XP_004237988.1| PREDICTED: AP-4 complex subunit mu-like [Solanum lycopersicum] Length = 452 Score = 60.5 bits (145), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 4472 YQNTQRGNITKEAGPVSMTFTIPMYNPSRLQVKF 4371 + GNITKEAGPVSMTFTIPMYNPSRLQVK+ Sbjct: 390 FSQESHGNITKEAGPVSMTFTIPMYNPSRLQVKY 423