BLASTX nr result
ID: Rauwolfia21_contig00001524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00001524 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFZ78556.1| cellulose synthase [Populus tomentosa] 72 6e-11 ref|XP_002308657.1| cellulose synthase family protein [Populus t... 72 6e-11 gb|AAO25536.1| cellulose synthase [Populus tremuloides] 72 6e-11 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] 72 1e-10 ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic su... 71 1e-10 gb|AFB18635.1| CESA6 [Gossypium hirsutum] 71 1e-10 gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium h... 71 1e-10 gb|AGV22109.1| cellulose synthase 7 [Betula luminifera] 71 2e-10 gb|AFZ78558.1| cellulose synthase [Populus tomentosa] 71 2e-10 ref|XP_002282575.2| PREDICTED: LOW QUALITY PROTEIN: cellulose sy... 71 2e-10 emb|CAN60659.1| hypothetical protein VITISV_018069 [Vitis vinifera] 71 2e-10 ref|XP_002324291.1| TGACG-motif binding family protein [Populus ... 70 3e-10 gb|AGC97433.2| cellulose synthase [Boehmeria nivea] 70 4e-10 gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] 70 4e-10 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus pe... 69 5e-10 gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis] 69 5e-10 ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UD... 69 5e-10 ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic su... 69 9e-10 ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic su... 67 2e-09 ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic su... 67 2e-09 >gb|AFZ78556.1| cellulose synthase [Populus tomentosa] Length = 1075 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS ST+ AA+GQCG+NC Sbjct: 1039 VWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa] gi|224143917|ref|XP_002336091.1| predicted protein [Populus trichocarpa] gi|222854633|gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa] Length = 1075 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS ST+ AA+GQCG+NC Sbjct: 1039 VWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >gb|AAO25536.1| cellulose synthase [Populus tremuloides] Length = 1083 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS ST+ AA+GQCG+NC Sbjct: 1047 VWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1083 >gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] Length = 1085 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ AA+GQCG+NC Sbjct: 1049 VWSILLASIFSLLWVRIDPFTSDATKSAANGQCGINC 1085 >ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Fragaria vesca subsp. vesca] Length = 1069 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ AA GQCGVNC Sbjct: 1033 VWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGVNC 1069 >gb|AFB18635.1| CESA6 [Gossypium hirsutum] Length = 1083 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ AA+GQCG+NC Sbjct: 1047 VWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 1083 >gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 657 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ AA+GQCG+NC Sbjct: 621 VWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 657 >gb|AGV22109.1| cellulose synthase 7 [Betula luminifera] Length = 1085 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS+S + AA+GQCG+NC Sbjct: 1049 VWSILLASIFSLLWVRIDPFTSASAKAAANGQCGINC 1085 >gb|AFZ78558.1| cellulose synthase [Populus tomentosa] Length = 1084 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTSS+T+ A+GQCG+NC Sbjct: 1048 VWSILLASIFSLLWVRIDPFTSSTTQTTANGQCGINC 1084 >ref|XP_002282575.2| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Vitis vinifera] Length = 1224 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTSSST+ AASGQCG+NC Sbjct: 1189 VWSILLASIFSLLWVRIDPFTSSSTK-AASGQCGINC 1224 >emb|CAN60659.1| hypothetical protein VITISV_018069 [Vitis vinifera] Length = 1097 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTSSST+ AASGQCG+NC Sbjct: 1062 VWSILLASIFSLLWVRIDPFTSSSTK-AASGQCGINC 1097 >ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa] gi|222865725|gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa] Length = 1084 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ A++GQCGVNC Sbjct: 1048 VWSILLASIFSLLWVRIDPFTSGTTQTASNGQCGVNC 1084 >gb|AGC97433.2| cellulose synthase [Boehmeria nivea] Length = 1082 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ A+ GQCGVNC Sbjct: 1046 VWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 1082 >gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] Length = 938 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS +T+ A+ GQCGVNC Sbjct: 902 VWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 938 >gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] Length = 1072 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFT+ +T+ A++GQCGVNC Sbjct: 1036 VWSILLASIFSLLWVRIDPFTNDATKAASNGQCGVNC 1072 >gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis] Length = 1085 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS++T A+GQCG+NC Sbjct: 1049 VWSILLASIFSLLWVRIDPFTSATTTSTANGQCGINC 1085 >ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] gi|223545480|gb|EEF46985.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] Length = 1083 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS + + AA+GQCG+NC Sbjct: 1047 VWSILLASIFSLLWVRIDPFTSDAAKAAANGQCGINC 1083 >ref|XP_004136343.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Cucumis sativus] gi|449524318|ref|XP_004169170.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Cucumis sativus] Length = 1081 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VWSILLASIFSLLWVRIDPFTS+ST+ AA+GQCG+NC Sbjct: 1046 VWSILLASIFSLLWVRIDPFTSASTK-AANGQCGINC 1081 >ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Solanum tuberosum] Length = 1086 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VW++LLASIFSLLWVRIDPFTS +++ AA GQCG+NC Sbjct: 1050 VWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Solanum lycopersicum] Length = 1086 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 3 VWSILLASIFSLLWVRIDPFTSSSTRQAASGQCGVNC 113 VW++LLASIFSLLWVRIDPFTS +++ AA GQCG+NC Sbjct: 1050 VWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086