BLASTX nr result
ID: Rauwolfia21_contig00000475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rauwolfia21_contig00000475 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65627.1| hypothetical protein VITISV_032735 [Vitis vinifera] 67 2e-09 emb|CAN77149.1| hypothetical protein VITISV_019364 [Vitis vinifera] 67 2e-09 gb|ABI34377.1| Polyprotein, putative [Solanum demissum] 63 4e-08 gb|EOX98948.1| Polyprotein-like protein [Theobroma cacao] 55 1e-05 >emb|CAN65627.1| hypothetical protein VITISV_032735 [Vitis vinifera] Length = 1285 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +2 Query: 275 SFSPLGVILRENKLTGPNYVDWKRNLNIVLTAQEYKYVLTDPC-PXXXXXXXXXXXXAHR 451 SF+PL IL +NKL GPNYVDWKRNL+I+ TA+EYK+VL++ C AH+ Sbjct: 3 SFNPLANILTQNKLEGPNYVDWKRNLDILQTAEEYKFVLSEVCLEKPGEGATQDQIKAHQ 62 Query: 452 AWKK 463 W K Sbjct: 63 KWVK 66 >emb|CAN77149.1| hypothetical protein VITISV_019364 [Vitis vinifera] Length = 1544 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +2 Query: 275 SFSPLGVILRENKLTGPNYVDWKRNLNIVLTAQEYKYVLTDPC-PXXXXXXXXXXXXAHR 451 SF+PL IL + KL GPNYVDWKRNL+I+LTA+EYK+VL++ C AH+ Sbjct: 324 SFNPLANILTQXKLEGPNYVDWKRNLDILLTAEEYKFVLSEVCLEKPGEGATQDQIKAHQ 383 Query: 452 AWKK 463 W K Sbjct: 384 KWVK 387 >gb|ABI34377.1| Polyprotein, putative [Solanum demissum] Length = 233 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +2 Query: 278 FSPLGVILRENKLTGPNYVDWKRNLNIVLTAQEYKYVLTDPCP 406 F+P+ IL +NKL G NYVDW+R L+IVLTA+EYK+VL + CP Sbjct: 4 FNPISTILDQNKLEGSNYVDWRRILDIVLTAEEYKFVLHEECP 46 >gb|EOX98948.1| Polyprotein-like protein [Theobroma cacao] Length = 357 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +2 Query: 275 SFSPLGVILRENKLTGPNYVDWKRNLNIVLTAQEYKYVLTDPCP 406 +F+PL IL +N+L+GP Y+DW+RNL IVLT ++ YVLT P Sbjct: 3 NFNPLSKILDDNRLSGPYYIDWQRNLTIVLTIEKIAYVLTTDPP 46