BLASTX nr result
ID: Phellodendron21_contig00047191
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00047191 (366 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO73305.1 hypothetical protein CISIN_1g037773mg [Citrus sinensis] 65 8e-11 >KDO73305.1 hypothetical protein CISIN_1g037773mg [Citrus sinensis] Length = 139 Score = 64.7 bits (156), Expect = 8e-11 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -3 Query: 286 KQLLCLPLKGSKDMEPMSYKIYVLFIKSTSECHTRPSL*ACIFL 155 KQ+LCLPLK SKDMEP +KI++LFIKSTSEC R SL AC + Sbjct: 66 KQVLCLPLKDSKDMEPNIFKIFILFIKSTSECSRRASLWACFII 109