BLASTX nr result
ID: Phellodendron21_contig00047180
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00047180 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006431157.1 hypothetical protein CICLE_v10011507mg [Citrus cl... 58 8e-08 XP_006482602.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 58 8e-08 XP_012084708.1 PREDICTED: ATP-dependent zinc metalloprotease FTS... 53 5e-06 >XP_006431157.1 hypothetical protein CICLE_v10011507mg [Citrus clementina] ESR44397.1 hypothetical protein CICLE_v10011507mg [Citrus clementina] KDO72580.1 hypothetical protein CISIN_1g046312mg [Citrus sinensis] Length = 514 Score = 57.8 bits (138), Expect = 8e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -3 Query: 259 VFINTNLVHFYESCERKIDACKVFDDMCERNLVSRQ*QNSVC 134 V+ N NLV FY SC RK DACKVFDDMCER++VS +VC Sbjct: 164 VYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVC 205 >XP_006482602.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 6, chloroplastic-like [Citrus sinensis] Length = 1197 Score = 57.8 bits (138), Expect = 8e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -3 Query: 259 VFINTNLVHFYESCERKIDACKVFDDMCERNLVSRQ*QNSVC 134 V+ N NLV FY SC RK DACKVFDDMCER++VS +VC Sbjct: 847 VYTNNNLVRFYGSCRRKRDACKVFDDMCERSVVSWNVIITVC 888 >XP_012084708.1 PREDICTED: ATP-dependent zinc metalloprotease FTSH 6, chloroplastic [Jatropha curcas] Length = 1159 Score = 52.8 bits (125), Expect = 5e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 259 VFINTNLVHFYESCERKIDACKVFDDMCERNLVS 158 V++N NLVHFY SC++ DA KVFD+MCER LVS Sbjct: 807 VYVNNNLVHFYGSCKKIRDARKVFDEMCERTLVS 840