BLASTX nr result
ID: Phellodendron21_contig00046943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046943 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013348936.1 hypothetical protein AUEXF2481DRAFT_24757 [Aureob... 59 8e-08 KEQ62862.1 eukaryotic translation initiation factor-like protein... 59 1e-07 XP_013427398.1 eukaryotic translation initiation factor 3 subuni... 59 1e-07 KEQ87972.1 eukaryotic translation initiation factor 3 subunit F ... 59 1e-07 GAM87308.1 hypothetical protein ANO11243_053300 [fungal sp. No.1... 59 2e-07 KJX96436.1 eukaryotic translation initiation factor 3 subunit f ... 56 1e-06 CRK37158.1 hypothetical protein BN1708_007348, partial [Verticil... 53 1e-06 KXS97975.1 hypothetical protein AC578_3122 [Mycosphaerella eumusae] 55 2e-06 XP_007924528.1 hypothetical protein MYCFIDRAFT_135624 [Pseudocer... 55 2e-06 XP_003848149.1 hypothetical protein MYCGRDRAFT_106350 [Zymosepto... 55 3e-06 XP_007803721.1 Eukaryotic translation initiation factor 3 subuni... 55 5e-06 CEN62129.1 Putative Eukaryotic translation initiation factor 3 s... 54 6e-06 XP_001795271.1 hypothetical protein SNOG_04858 [Parastagonospora... 54 8e-06 XP_008020483.1 hypothetical protein SETTUDRAFT_86770 [Setosphaer... 54 8e-06 XP_018380175.1 Mov34-domain-containing protein [Alternaria alter... 54 8e-06 KNG47993.1 eukaryotic translation initiation factor 3 subunit f ... 54 8e-06 XP_007691714.1 hypothetical protein COCMIDRAFT_40099 [Bipolaris ... 54 8e-06 XP_007695520.1 hypothetical protein COCSADRAFT_33354 [Bipolaris ... 54 8e-06 XP_001934230.1 eukaryotic translation initiation factor 3 subuni... 54 8e-06 XP_003296179.1 hypothetical protein PTT_05277 [Pyrenophora teres... 54 8e-06 >XP_013348936.1 hypothetical protein AUEXF2481DRAFT_24757 [Aureobasidium subglaciale EXF-2481] KER00429.1 hypothetical protein AUEXF2481DRAFT_24757 [Aureobasidium subglaciale EXF-2481] Length = 259 Score = 59.3 bits (142), Expect = 8e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQT 103 VLLVSYLANTIRTQIDLSNRLATA LTMG E+ T Sbjct: 191 VLLVSYLANTIRTQIDLSNRLATAALTMGTETST 224 >KEQ62862.1 eukaryotic translation initiation factor-like protein 3 subunit F [Aureobasidium melanogenum CBS 110374] Length = 342 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQT 103 VLLVSYLANTIRTQIDLSNRLATA LTMG E+ T Sbjct: 279 VLLVSYLANTIRTQIDLSNRLATAALTMGTEAST 312 >XP_013427398.1 eukaryotic translation initiation factor 3 subunit F [Aureobasidium namibiae CBS 147.97] KEQ73437.1 eukaryotic translation initiation factor 3 subunit F [Aureobasidium namibiae CBS 147.97] Length = 344 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQT 103 VLLVSYLANTIRTQIDLSNRLATA LTMG E+ T Sbjct: 279 VLLVSYLANTIRTQIDLSNRLATAALTMGTETNT 312 >KEQ87972.1 eukaryotic translation initiation factor 3 subunit F [Aureobasidium pullulans EXF-150] Length = 346 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQT 103 VLLVSYLANTIRTQIDLSNRLATA LTMG E+ T Sbjct: 279 VLLVSYLANTIRTQIDLSNRLATAALTMGGEANT 312 >GAM87308.1 hypothetical protein ANO11243_053300 [fungal sp. No.11243] Length = 342 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNES 97 VLLVSYLANTIRTQIDLSNRLATA LTMG ES Sbjct: 278 VLLVSYLANTIRTQIDLSNRLATAALTMGGES 309 >KJX96436.1 eukaryotic translation initiation factor 3 subunit f like protein [Zymoseptoria brevis] Length = 356 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNE 94 VLLVSYLANTIRTQIDLSNRLATA LTMG E Sbjct: 278 VLLVSYLANTIRTQIDLSNRLATAALTMGPE 308 >CRK37158.1 hypothetical protein BN1708_007348, partial [Verticillium longisporum] Length = 84 Score = 52.8 bits (125), Expect = 1e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQTNTA 112 VL+VSYLANTIR QIDLS RLATATL MG + N A Sbjct: 2 VLMVSYLANTIRNQIDLSQRLATATLNMGEKDGENKA 38 >KXS97975.1 hypothetical protein AC578_3122 [Mycosphaerella eumusae] Length = 328 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNES 97 VLLVSYLANTIRTQIDLSNRLATATL +G+ S Sbjct: 279 VLLVSYLANTIRTQIDLSNRLATATLNLGDPS 310 >XP_007924528.1 hypothetical protein MYCFIDRAFT_135624 [Pseudocercospora fijiensis CIRAD86] EME83904.1 hypothetical protein MYCFIDRAFT_135624 [Pseudocercospora fijiensis CIRAD86] Length = 328 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNES 97 VLLVSYLANTIRTQIDLSNRLATATL +G+ S Sbjct: 279 VLLVSYLANTIRTQIDLSNRLATATLNLGDPS 310 >XP_003848149.1 hypothetical protein MYCGRDRAFT_106350 [Zymoseptoria tritici IPO323] EGP83125.1 hypothetical protein MYCGRDRAFT_106350 [Zymoseptoria tritici IPO323] Length = 356 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNE 94 VLLVSYL+NTIRTQIDLSNRLATA LTMG E Sbjct: 278 VLLVSYLSNTIRTQIDLSNRLATAALTMGPE 308 >XP_007803721.1 Eukaryotic translation initiation factor 3 subunit F [Endocarpon pusillum Z07020] ERF70663.1 Eukaryotic translation initiation factor 3 subunit F [Endocarpon pusillum Z07020] Length = 358 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQTNTA 112 VL VSYLANTIRTQ+DLSNRLATA LTMG T+ A Sbjct: 284 VLAVSYLANTIRTQMDLSNRLATAQLTMGGPESTSLA 320 >CEN62129.1 Putative Eukaryotic translation initiation factor 3 subunit F [Aspergillus calidoustus] Length = 345 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMGNESQT 103 VL+VSYLANTIRTQ++LSNRLATA LT+G ES T Sbjct: 280 VLVVSYLANTIRTQMELSNRLATAQLTLGGESGT 313 >XP_001795271.1 hypothetical protein SNOG_04858 [Parastagonospora nodorum SN15] Q0UTQ6.1 RecName: Full=Eukaryotic translation initiation factor 3 subunit F; Short=eIF3f EAT87249.1 hypothetical protein SNOG_04858 [Parastagonospora nodorum SN15] Length = 342 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >XP_008020483.1 hypothetical protein SETTUDRAFT_86770 [Setosphaeria turcica Et28A] EOA92121.1 hypothetical protein SETTUDRAFT_86770 [Setosphaeria turcica Et28A] Length = 343 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >XP_018380175.1 Mov34-domain-containing protein [Alternaria alternata] OAG14754.1 Mov34-domain-containing protein [Alternaria alternata] Length = 344 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >KNG47993.1 eukaryotic translation initiation factor 3 subunit f [Stemphylium lycopersici] Length = 344 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >XP_007691714.1 hypothetical protein COCMIDRAFT_40099 [Bipolaris oryzae ATCC 44560] XP_007713795.1 hypothetical protein COCCADRAFT_100052 [Bipolaris zeicola 26-R-13] XP_014074445.1 hypothetical protein COCC4DRAFT_205504 [Bipolaris maydis ATCC 48331] XP_014558645.1 hypothetical protein COCVIDRAFT_24866 [Bipolaris victoriae FI3] EMD96640.1 hypothetical protein COCHEDRAFT_1220233 [Bipolaris maydis C5] ENI00536.1 hypothetical protein COCC4DRAFT_205504 [Bipolaris maydis ATCC 48331] EUC31923.1 hypothetical protein COCCADRAFT_100052 [Bipolaris zeicola 26-R-13] EUC41769.1 hypothetical protein COCMIDRAFT_40099 [Bipolaris oryzae ATCC 44560] EUN29079.1 hypothetical protein COCVIDRAFT_24866 [Bipolaris victoriae FI3] Length = 344 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >XP_007695520.1 hypothetical protein COCSADRAFT_33354 [Bipolaris sorokiniana ND90Pr] EMD68446.1 hypothetical protein COCSADRAFT_33354 [Bipolaris sorokiniana ND90Pr] Length = 344 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >XP_001934230.1 eukaryotic translation initiation factor 3 subunit F [Pyrenophora tritici-repentis Pt-1C-BFP] EDU46735.1 eukaryotic translation initiation factor 3 subunit F [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 345 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308 >XP_003296179.1 hypothetical protein PTT_05277 [Pyrenophora teres f. teres 0-1] EFQ95723.1 hypothetical protein PTT_05277 [Pyrenophora teres f. teres 0-1] Length = 345 Score = 53.9 bits (128), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 VLLVSYLANTIRTQIDLSNRLATATLTMG 88 VL+VSYLANTIRTQIDLSNRLATA LTMG Sbjct: 280 VLVVSYLANTIRTQIDLSNRLATAALTMG 308