BLASTX nr result
ID: Phellodendron21_contig00046933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046933 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005647180.1 hypothetical protein COCSUDRAFT_66322 [Coccomyxa ... 60 2e-09 >XP_005647180.1 hypothetical protein COCSUDRAFT_66322 [Coccomyxa subellipsoidea C-169] EIE22636.1 hypothetical protein COCSUDRAFT_66322 [Coccomyxa subellipsoidea C-169] Length = 131 Score = 60.5 bits (145), Expect = 2e-09 Identities = 46/105 (43%), Positives = 55/105 (52%), Gaps = 12/105 (11%) Frame = +2 Query: 59 SSVSIRAPVSARPTCT------PFQRSIRAPKRANLQIVAIGEINDPEKTAQAKEKKHSE 220 S++S +S RP+ P R + AP RAN IGE+NDPEKT + KEKK + Sbjct: 5 SAMSTSVLLSTRPSVARPGVQRPAPRRL-APLRAN---PFIGEVNDPEKTKKNKEKKDHD 60 Query: 221 GQWAEPHNKNKLEKKPIMRGDPGVAS-----ETEGNPL-EGVKDA 337 WAEP N N LEK + R G S E E N EGVKDA Sbjct: 61 SVWAEPKNNNPLEKTTLSREGFGKQSKQMKDEQEVNKFTEGVKDA 105