BLASTX nr result
ID: Phellodendron21_contig00046876
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046876 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005646533.1 Reticulon-domain-containing protein [Coccomyxa su... 57 6e-07 >XP_005646533.1 Reticulon-domain-containing protein [Coccomyxa subellipsoidea C-169] EIE21989.1 Reticulon-domain-containing protein [Coccomyxa subellipsoidea C-169] Length = 593 Score = 56.6 bits (135), Expect = 6e-07 Identities = 33/61 (54%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -1 Query: 182 QRVSLPVDN-QLEGLLLWRDPVKTGGVFAGITLVYLLLEWSHYSLLTVIARVGLFAVVGS 6 Q + P N +L LL DP K+G VFAG TL YLLLEWSH+SLL++IA L AV + Sbjct: 375 QEMGFPSGNIRLHNLL---DPKKSGVVFAGATLAYLLLEWSHFSLLSIIANTLLIAVSVA 431 Query: 5 F 3 F Sbjct: 432 F 432