BLASTX nr result
ID: Phellodendron21_contig00046858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046858 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCQ38381.1 adenosyl-homocysteine hydrolase, partial [Schiedea la... 80 1e-17 XP_002950429.1 hypothetical protein VOLCADRAFT_74602 [Volvox car... 86 3e-17 CCQ38404.1 adenosyl-homocysteine hydrolase, partial [Schiedea tr... 78 4e-17 KXZ53469.1 hypothetical protein GPECTOR_7g919 [Gonium pectorale] 85 7e-17 WP_056621556.1 hypothetical protein [Brevundimonas sp. Root1423]... 78 7e-17 AQK49908.1 Adenosylhomocysteinase [Zea mays] 80 1e-16 ABK25129.1 unknown [Picea sitchensis] 84 2e-16 ABK24229.1 unknown [Picea sitchensis] ACN40819.1 unknown [Picea ... 84 2e-16 WP_062278074.1 hypothetical protein [Marichromatium gracile] KXX... 80 3e-16 XP_010097949.1 hypothetical protein L484_026840 [Morus notabilis... 83 4e-16 XP_002987608.1 hypothetical protein SELMODRAFT_158886 [Selaginel... 83 4e-16 KMZ66813.1 Adenosylhomocysteinase [Zostera marina] 83 4e-16 ABR16616.1 unknown [Picea sitchensis] 82 5e-16 XP_016566151.1 PREDICTED: adenosylhomocysteinase [Capsicum annuum] 82 5e-16 AAP92452.1 S-adenosyl-L-homocystein hydrolase [Petunia x hybrida] 82 5e-16 XP_009373550.1 PREDICTED: adenosylhomocysteinase [Pyrus x bretsc... 82 5e-16 ACN40278.1 unknown [Picea sitchensis] 82 5e-16 ABR16547.1 unknown [Picea sitchensis] ABR18363.1 unknown [Picea ... 82 5e-16 ABR17322.1 unknown [Picea sitchensis] 82 5e-16 ABR16138.1 unknown [Picea sitchensis] 82 5e-16 >CCQ38381.1 adenosyl-homocysteine hydrolase, partial [Schiedea laui] CCQ38382.1 adenosyl-homocysteine hydrolase, partial [Schiedea pentandra] CCQ38383.1 adenosyl-homocysteine hydrolase, partial [Schiedea jacobii] CCQ38384.1 adenosyl-homocysteine hydrolase, partial [Schiedea kaalae] CCQ38385.1 adenosyl-homocysteine hydrolase, partial [Schiedea kauaiensis] CCQ38386.1 adenosyl-homocysteine hydrolase, partial [Schiedea perlmanii] CCQ38387.1 adenosyl-homocysteine hydrolase, partial [Schiedea nuttallii] CCQ38388.1 adenosyl-homocysteine hydrolase, partial [Schiedea stellarioides] CCQ38389.1 adenosyl-homocysteine hydrolase, partial [Schiedea spergulina] CCQ38390.1 adenosyl-homocysteine hydrolase, partial [Schiedea kealiae] CCQ38391.1 adenosyl-homocysteine hydrolase, partial [Schiedea mannii] CCQ38392.1 adenosyl-homocysteine hydrolase, partial [Schiedea adamantis] CCQ38393.1 adenosyl-homocysteine hydrolase, partial [Schiedea menziesii] CCQ38394.1 adenosyl-homocysteine hydrolase, partial [Schiedea hookeri] CCQ38395.1 adenosyl-homocysteine hydrolase, partial [Schiedea sarmentosa] CCQ38396.1 adenosyl-homocysteine hydrolase, partial [Schiedea lydgatei] CCQ38397.1 adenosyl-homocysteine hydrolase, partial [Schiedea haleakalensis] CCQ38398.1 adenosyl-homocysteine hydrolase, partial [Schiedea ligustrina] CCQ38399.1 adenosyl-homocysteine hydrolase, partial [Schiedea salicaria] CCQ38400.1 adenosyl-homocysteine hydrolase, partial [Schiedea globosa] CCQ38401.1 adenosyl-homocysteine hydrolase, partial [Schiedea apokremnos] CCQ38402.1 adenosyl-homocysteine hydrolase, partial [Schiedea helleri] CCQ38403.1 adenosyl-homocysteine hydrolase, partial [Schiedea membranacea] CCQ38405.1 adenosyl-homocysteine hydrolase, partial [Schiedea obovata] CCQ38406.1 adenosyl-homocysteine hydrolase, partial [Schiedea viscosa] CCQ38407.1 adenosyl-homocysteine hydrolase, partial [Schiedea verticillata] Length = 50 Score = 79.7 bits (195), Expect = 1e-17 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT LTK+Q+ Y+++PV GPYKP+HYRY Sbjct: 6 KHLDEKVAALHLGKLGAKLTKLTKDQSDYLSIPVEGPYKPVHYRY 50 >XP_002950429.1 hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis] EFJ48630.1 hypothetical protein VOLCADRAFT_74602 [Volvox carteri f. nagariensis] Length = 483 Score = 85.9 bits (211), Expect = 3e-17 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGAKLT L+ EQA YINVPV GPYKPLHYRY Sbjct: 439 KHLDEKVAALHLPKLGAKLTRLSPEQATYINVPVDGPYKPLHYRY 483 >CCQ38404.1 adenosyl-homocysteine hydrolase, partial [Schiedea trinervis] Length = 50 Score = 78.2 bits (191), Expect = 4e-17 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKL+ LTK+Q+ Y+++PV GPYKP+HYRY Sbjct: 6 KHLDEKVAALHLGKLGAKLSKLTKDQSDYLSIPVEGPYKPVHYRY 50 >KXZ53469.1 hypothetical protein GPECTOR_7g919 [Gonium pectorale] Length = 483 Score = 84.7 bits (208), Expect = 7e-17 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGAKLT L+ EQA YINVP+ GPYKPLHYRY Sbjct: 439 KHLDEKVAALHLPKLGAKLTRLSAEQATYINVPLDGPYKPLHYRY 483 >WP_056621556.1 hypothetical protein [Brevundimonas sp. Root1423] KQY62748.1 hypothetical protein ASD25_28920 [Brevundimonas sp. Root1423] Length = 75 Score = 78.2 bits (191), Expect = 7e-17 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVA LHL KLGAKLTTL+KEQA YI+VP GP+KP HYRY Sbjct: 31 KHLDEKVAMLHLGKLGAKLTTLSKEQADYISVPTEGPFKPXHYRY 75 >AQK49908.1 Adenosylhomocysteinase [Zea mays] Length = 154 Score = 80.1 bits (196), Expect = 1e-16 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT LTK QA YI+VP+ GPYKP HYRY Sbjct: 110 KHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY 154 >ABK25129.1 unknown [Picea sitchensis] Length = 485 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGAKLT L+ +QA+YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY 485 >ABK24229.1 unknown [Picea sitchensis] ACN40819.1 unknown [Picea sitchensis] Length = 485 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGAKLT L+ +QA+YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY 485 >WP_062278074.1 hypothetical protein [Marichromatium gracile] KXX63296.1 hypothetical protein AY586_16695 [Marichromatium gracile] Length = 183 Score = 79.7 bits (195), Expect = 3e-16 Identities = 38/45 (84%), Positives = 39/45 (86%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT LTKEQA YI+V GPYKPLHYRY Sbjct: 139 KHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY 183 >XP_010097949.1 hypothetical protein L484_026840 [Morus notabilis] EXB73679.1 hypothetical protein L484_026840 [Morus notabilis] Length = 485 Score = 82.8 bits (203), Expect = 4e-16 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT LTKEQA YI+VPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY 485 >XP_002987608.1 hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii] XP_002987645.1 hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii] EFJ11220.1 hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii] EFJ11444.1 hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii] Length = 485 Score = 82.8 bits (203), Expect = 4e-16 Identities = 38/45 (84%), Positives = 40/45 (88%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGAKLT L+ +QA YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAHYRY 485 >KMZ66813.1 Adenosylhomocysteinase [Zostera marina] Length = 487 Score = 82.8 bits (203), Expect = 4e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGA+LT L+KEQA YI+VP+ GPYKP HYRY Sbjct: 443 KHLDEKVAALHLPKLGARLTKLSKEQADYISVPIEGPYKPAHYRY 487 >ABR16616.1 unknown [Picea sitchensis] Length = 450 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGA+LT L+ +QA+YINVPV GPYKP HYRY Sbjct: 406 KHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVDGPYKPAHYRY 450 >XP_016566151.1 PREDICTED: adenosylhomocysteinase [Capsicum annuum] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT LTKEQA YI+VPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY 485 >AAP92452.1 S-adenosyl-L-homocystein hydrolase [Petunia x hybrida] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT L+K+QA YINVPV GPYKP+HYRY Sbjct: 441 KHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVHYRY 485 >XP_009373550.1 PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHL KLGAKLT LTKEQA YI+VPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY 485 >ACN40278.1 unknown [Picea sitchensis] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGA+LT L+ +QA+YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY 485 >ABR16547.1 unknown [Picea sitchensis] ABR18363.1 unknown [Picea sitchensis] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGA+LT L+ +QA+YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY 485 >ABR17322.1 unknown [Picea sitchensis] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGA+LT L+ +QA+YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY 485 >ABR16138.1 unknown [Picea sitchensis] Length = 485 Score = 82.4 bits (202), Expect = 5e-16 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -2 Query: 349 KHLDEKVAALHLPKLGAKLTTLTKEQAKYINVPVTGPYKPLHYRY 215 KHLDEKVAALHLPKLGA+LT L+ +QA+YINVPV GPYKP HYRY Sbjct: 441 KHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY 485