BLASTX nr result
ID: Phellodendron21_contig00046758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00046758 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OBW69922.1 Uncharacterized protein AUREO_000310 [Aureobasidium p... 66 2e-10 GAM87371.1 hypothetical protein ANO11243_053950 [fungal sp. No.1... 57 2e-07 XP_018191624.1 Orotidine 5'-phosphate decarboxylase [Xylona heve... 57 2e-07 CRK14357.1 hypothetical protein BN1708_002631, partial [Verticil... 55 5e-07 KFY10612.1 hypothetical protein V491_07573, partial [Pseudogymno... 55 8e-07 KFX95092.1 hypothetical protein V490_04032 [Pseudogymnoascus sp.... 55 1e-06 KFX92445.1 hypothetical protein O988_07268 [Pseudogymnoascus sp.... 55 1e-06 CRK43595.1 hypothetical protein BN1723_019244, partial [Verticil... 55 1e-06 XP_009654213.1 orotidine 5'-phosphate decarboxylase [Verticilliu... 55 2e-06 CRK46041.1 hypothetical protein BN1723_016639, partial [Verticil... 55 2e-06 OBT55852.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascu... 54 3e-06 XP_018135070.1 orotidine 5'-phosphate decarboxylase [Pseudogymno... 54 3e-06 OBT47852.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascu... 54 3e-06 KFY52462.1 hypothetical protein V496_08439 [Pseudogymnoascus sp.... 54 3e-06 XP_012738459.1 orotidine 5'-phosphate decarboxylase [Pseudogymno... 54 3e-06 KFZ09008.1 hypothetical protein V501_05758 [Pseudogymnoascus sp.... 54 3e-06 KFY72853.1 hypothetical protein V499_07027 [Pseudogymnoascus sp.... 54 3e-06 OBT67897.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascu... 54 4e-06 KFY81557.1 hypothetical protein V500_11310 [Pseudogymnoascus sp.... 54 4e-06 KFY33612.1 hypothetical protein V494_07466 [Pseudogymnoascus sp.... 54 4e-06 >OBW69922.1 Uncharacterized protein AUREO_000310 [Aureobasidium pullulans] Length = 393 Score = 65.9 bits (159), Expect = 2e-10 Identities = 41/97 (42%), Positives = 52/97 (53%) Frame = -2 Query: 292 DRSGRKHXXXXXXXXXXXXXXXXSPQPTPLHHRGXXXXXXXXXXXXAVEDWAAAHATLGD 113 D +GRK SPQPTP HH G A ++ ++A A LG+ Sbjct: 203 DPTGRKPSVVSVSTTISTKTESISPQPTPNHHGGPNDSISSISAGSAGQE-SSALARLGE 261 Query: 112 PPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 PP+ R LL+LAEMSSAGNLM +Y+ CV AR+N E Sbjct: 262 PPLLRSLLILAEMSSAGNLMTGSYTEQCVVEARKNPE 298 >GAM87371.1 hypothetical protein ANO11243_053950 [fungal sp. No.11243] Length = 274 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -2 Query: 121 LGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLAR 14 LG+PPMARGLLLLA+MSSAGN++D +Y++ CV+ AR Sbjct: 145 LGEPPMARGLLLLAQMSSAGNMLDDSYAAKCVEAAR 180 >XP_018191624.1 Orotidine 5'-phosphate decarboxylase [Xylona heveae TC161] KZF26069.1 Orotidine 5'-phosphate decarboxylase [Xylona heveae TC161] Length = 369 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -2 Query: 145 DWAAAHATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 D A LG PP+ARGLLLLAEMSS GNL+ AY+ C+D+AR + + Sbjct: 226 DREKALEALGSPPLARGLLLLAEMSSEGNLLTGAYTQKCIDIARDHND 273 >CRK14357.1 hypothetical protein BN1708_002631, partial [Verticillium longisporum] Length = 147 Score = 54.7 bits (130), Expect = 5e-07 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 130 HATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNR 5 +A + +PPM RGLL+LA+MSSAGN M+ Y+ CV+ AR NR Sbjct: 8 YAGIEEPPMERGLLILAQMSSAGNFMNQEYTQACVEAARENR 49 >KFY10612.1 hypothetical protein V491_07573, partial [Pseudogymnoascus sp. VKM F-3775] Length = 251 Score = 55.5 bits (132), Expect = 8e-07 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = -2 Query: 121 LGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 L + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR+N++ Sbjct: 119 LEEAPLDRGLLLLAQMSSAGNLLDDAYAKACVEIARKNKD 158 >KFX95092.1 hypothetical protein V490_04032 [Pseudogymnoascus sp. VKM F-3557] KFY37941.1 hypothetical protein V495_06840 [Pseudogymnoascus sp. VKM F-4514 (FW-929)] KFY67554.1 hypothetical protein V497_00333 [Pseudogymnoascus sp. VKM F-4516 (FW-969)] Length = 875 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -2 Query: 127 ATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 A L + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR+N + Sbjct: 741 AGLEEAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARKNTD 782 >KFX92445.1 hypothetical protein O988_07268 [Pseudogymnoascus sp. VKM F-3808] Length = 875 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = -2 Query: 127 ATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 A L + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR+N + Sbjct: 741 AGLEEAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARKNTD 782 >CRK43595.1 hypothetical protein BN1723_019244, partial [Verticillium longisporum] Length = 235 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 130 HATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNR 5 +A + +PPM RGLL+LA+MSSAGN M+ Y+ CV+ AR NR Sbjct: 96 YAGIEEPPMERGLLILAQMSSAGNFMNQEYTQACVEAARENR 137 >XP_009654213.1 orotidine 5'-phosphate decarboxylase [Verticillium dahliae VdLs.17] EGY15849.1 orotidine 5'-phosphate decarboxylase [Verticillium dahliae VdLs.17] Length = 367 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 130 HATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNR 5 +A + +PPM RGLL+LA+MSSAGN M+ Y+ CV+ AR NR Sbjct: 228 YAGIEEPPMERGLLILAQMSSAGNFMNQEYTQACVEAARENR 269 >CRK46041.1 hypothetical protein BN1723_016639, partial [Verticillium longisporum] Length = 538 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 130 HATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNR 5 +A + +PPM RGLL+LA+MSSAGN M+ Y+ CV+ AR NR Sbjct: 228 YAGIEEPPMERGLLILAQMSSAGNFMNQEYTQACVEAARENR 269 >OBT55852.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus sp. 24MN13] Length = 335 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N++ Sbjct: 205 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNKD 242 >XP_018135070.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus verrucosus] OBU01338.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus verrucosus] Length = 357 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N++ Sbjct: 227 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNKD 264 >OBT47852.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus sp. WSF 3629] Length = 357 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N++ Sbjct: 227 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNKD 264 >KFY52462.1 hypothetical protein V496_08439 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY95749.1 hypothetical protein V498_03145 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] Length = 357 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY++ CV++AR+N + Sbjct: 227 EAPLDRGLLLLAQMSSAGNLLDEAYATACVEIARKNTD 264 >XP_012738459.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus destructans 20631-21] ELR01695.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus destructans 20631-21] OAF62563.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus destructans] Length = 357 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N++ Sbjct: 227 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNKD 264 >KFZ09008.1 hypothetical protein V501_05758 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] Length = 385 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N++ Sbjct: 255 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNKD 292 >KFY72853.1 hypothetical protein V499_07027 [Pseudogymnoascus sp. VKM F-103] Length = 385 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N++ Sbjct: 255 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNKD 292 >OBT67897.1 orotidine 5'-phosphate decarboxylase [Pseudogymnoascus sp. 23342-1-I1] Length = 357 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR+N + Sbjct: 227 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARKNTD 264 >KFY81557.1 hypothetical protein V500_11310 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ10561.1 hypothetical protein V502_08046 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] Length = 357 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = -2 Query: 127 ATLGDPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 A + + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR N + Sbjct: 223 AGIEEAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARNNTD 264 >KFY33612.1 hypothetical protein V494_07466 [Pseudogymnoascus sp. VKM F-4513 (FW-928)] Length = 888 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -2 Query: 115 DPPMARGLLLLAEMSSAGNLMDAAYSSTCVDLARRNRE 2 + P+ RGLLLLA+MSSAGNL+D AY+ CV++AR+N + Sbjct: 758 EAPLDRGLLLLAQMSSAGNLLDEAYAKACVEIARKNTD 795